Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 9:37 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page Previous  1, 2, 3  Next
Author Message
PostPosted: Tue Feb 10, 2015 11:55 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI493022 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI544772 A/chicken/Shanghai/LPM2/2013 (A/H3N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI544765 A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI469411 A/common teal/Hong Kong/MPK630/2009 (A/H10N9) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI387896 A/wild bird/Korea/A13/2010 (A/H10N1) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI387895 A/wild bird/Korea/A12/2010 (A/H10N1) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI476581 A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI469483 A/chicken/Jiangxi/2369/2010 (A/H7N7) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI469333 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI372456 A/shoveler/Egypt/01574-NAMRU3/2007 (A/H10N4) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI446505 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)
EPI372273 A/teal/Egypt/20431-NAMRU3/2003 (A/H1N2) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)
EPI461627 A/duck/Hunan/S1256/2012 (A/H3N8) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI461569 A/duck/Hunan/S11313/2012 (A/H4N2) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI285821 A/avian/Egypt/920431/2006 (A/H9N2) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI533778 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 2 (PB1) 3801.5 0.000000e+00 2203/2275 (96%)
EPI533772 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 2 (PB1) 3801.5 0.000000e+00 2203/2275 (96%)
EPI469432 A/wild waterfowl/Hong Kong/MPL1060/2011 (A/H11N9) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI469398 A/common teal/Hong Kong/MPL1075/2011 (A/H11N9) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI461661 A/duck/Hunan/S1824/2012 (A/H3N8) segment 2 (PB1) 3796.0 0.000000e+00 2202/2275 (96%)
EPI222162 A/mallard/Altai/1208/2007 (A/H3N6) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI222093 A/garganey/Altai/1216/2007 (A/H3N6) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI372313 A/shoveler/Egypt/09782-NAMRU3/2004 (A/H10N7) segment 2 (PB1) 3779.4 0.000000e+00 2198/2274 (96%)
EPI469402 A/northern shoveler/Hong Kong/MPC657/2006 (A/H10N9) segment 2 (PB1) 3773.8 0.000000e+00 2198/2275 (96%)
EPI372353 A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 2 (PB1) 3773.8 0.000000e+00 2197/2274 (96%)
EPI269009 A/duck/Hunan/491/2005 (A/H6N2) segment 2 (PB1) 3773.8 0.000000e+00 2197/2274 (96%)
EPI229961 A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1) 3773.8 0.000000e+00 2197/2274 (96%)
EPI181975 A/common teal/Netherlands/1/2005 (A/H8N4) segment 2 (PB1) 3773.8 0.000000e+00 2197/2274 (96%)
EPI169291 A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1) 3773.8 0.000000e+00 2197/2274 (96%)
EPI554980 A/mallard/Italy/3342/2006 (A/H3N6) segment 2 (PB1) 3768.3 0.000000e+00 2197/2275 (96%)
EPI461833 A/environment/Hunan/S4484/2011 (A/H12N7) segment 2 (PB1) 3768.3 0.000000e+00 2197/2275 (96%)
EPI377678 A/mallard/Sweden/99/2002 (A/H2N3) segment 2 (PB1) 3768.3 0.000000e+00 2196/2274 (96%)
EPI270060 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 2 (PB1) 3768.3 0.000000e+00 2196/2274 (96%)
EPI514657 A/mallard/Sweden/6134/2005 (A/H4N6) segment 2 (PB1) 3762.7 0.000000e+00 2195/2274 (96%)
EPI511808 A/mallard/Italy/4518/2007 (A/H10N1) segment 2 (PB1) 3762.7 0.000000e+00 2195/2274 (96%)
EPI372479 A/teal/Egypt/12908-NAMRU3/2005 (A/H10N1) segment 2 (PB1) 3762.7 0.000000e+00 2195/2274 (96%)
EPI514681 A/mallard/Sweden/5714/2005 (A/H4N6) segment 2 (PB1) 3757.2 0.000000e+00 2194/2274 (96%)
EPI485608 A/mallard/Sweden/16/2002 (A/H12N9) segment 2 (PB1) 3757.2 0.000000e+00 2194/2274 (96%)
EPI372384 A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 2 (PB1) 3757.2 0.000000e+00 2195/2275 (96%)
EPI372337 A/shoveler/Egypt/09781-NAMRU3/2004 (A/H10N7) segment 2 (PB1) 3757.2 0.000000e+00 2194/2274 (96%)
EPI254405 A/Egyptian goose/South Africa/AI1448/2007 (A/H1N8) segment 2 (PB1) 3757.2 0.000000e+00 2188/2265 (96%)
EPI173879 A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1) 3757.2 0.000000e+00 2195/2275 (96%)
EPI167837 A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1) 3757.2 0.000000e+00 2195/2275 (96%)
EPI514709 A/mallard/Sweden/5755/2005 (A/H4N6) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI469426 A/wild duck/Jiangxi/10179/2005 (A/H7N3) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI469414 A/duck/Yunnan/87/2007 (A/H7N6) segment 2 (PB1) 3751.7 0.000000e+00 2191/2271 (96%)
EPI417480 A/duck/Guangxi/GXd-2/2010 (A/H6N2) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI377662 A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI372487 A/garganey/Ukraine/05834-NAMRU3/2006 (A/H10N9) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI372265 A/shoveler/Egypt/20313-NAMRU3/2003 (A/H5N2) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI251767 A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1) 3751.7 0.000000e+00 2193/2274 (96%)
EPI514716 A/mallard/Sweden/5763/2005 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI514671 A/mallard/Sweden/7582/2003 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI514650 A/mallard/Sweden/5814/2005 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI514643 A/mallard/Sweden/5811/2005 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2193/2275 (96%)
EPI514636 A/mallard/Sweden/5803/2005 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2193/2275 (96%)
EPI514334 A/mallard/Sweden/52249/2006 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2193/2275 (96%)
EPI485651 A/mallard/Sweden/64/2003 (A/H7N7) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI401307 A/duck/Korea/DY104/2007 (A/H4N6) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI377772 A/mallard/Sweden/30/2002 (A/H2N5) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI251814 A/mallard/Sweden/86/2003 (A/H12N5) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI178534 A/Duck/Italy/62330/2006 (A/H10N7) segment 2 (PB1) 3746.1 0.000000e+00 2192/2274 (96%)
EPI387501 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 2 (PB1) 3744.3 0.000000e+00 2192/2274 (96%)
EPI514276 A/mallard/Sweden/52334/2006 (A/H4N6) segment 2 (PB1) 3740.6 0.000000e+00 2192/2275 (96%)
EPI514200 A/mallard/Sweden/52462/2006 (A/H4N6) segment 2 (PB1) 3740.6 0.000000e+00 2191/2274 (96%)
EPI514050 A/mallard/Sweden/68504/2007 (A/H4N2) segment 2 (PB1) 3740.6 0.000000e+00 2191/2274 (96%)
EPI439580 A/avian/Israel/824/2005 (A/H10N2) segment 2 (PB1) 3740.6 0.000000e+00 2192/2275 (96%)
EPI372369 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 2 (PB1) 3740.6 0.000000e+00 2191/2274 (96%)
EPI345546 A/chicken/Eastern China/42/2007 (A/H6N2) segment 2 (PB1) 3740.6 0.000000e+00 2191/2274 (96%)
EPI345545 A/chicken/Eastern China/44/2007 (A/H6N2) segment 2 (PB1) 3740.6 0.000000e+00 2191/2274 (96%)
EPI190338 A/mallard/Netherlands/22/2007 (A/H7N1) segment 2 (PB1) 3736.9 0.000000e+00 2189/2272 (96%)
EPI514012 A/mallard/Sweden/68551/2007 (A/H4N2) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI513968 A/mallard/Sweden/68677/2007 (A/H0) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI503967 A/wild duck/SH17-34/2008 (A/H2N3) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI469410 A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI401350 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI401293 A/wild duck/Korea/CSM4-28/2010 (A/H4N6) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI387899 A/wild bird/Korea/A01/2009 (A/H10N6) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI372494 A/pied avocet/Ukraine/05848-NAMRU3/2006 (A/H10N4) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI372472 A/teal/Ukraine/12177-NAMRU3/2005 (A/H7N9) segment 2 (PB1) 3735.0 0.000000e+00 2192/2276 (96%)
EPI363509 A/duck/Guizhou/888/2006 (A/H6N5) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI345544 A/chicken/Eastern China/45/2007 (A/H6N2) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI335394 A/aquatic bird/Korea/CN9/2009 (A/H6N8) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI299296 A/avian/Japan/8KI0129/2008 (A/H3N8) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI225317 A/northern pintail/Akita/714/2006 (A/H5N2) segment 2 (PB1) 3735.0 0.000000e+00 2190/2274 (96%)
EPI560339 A/Italy/3/2013 (A/H7N7) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI514003 A/mallard/Sweden/68940/2007 (A/H4N2) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI513699 A/mallard/Sweden/80014/2008 (A/H4N6) segment 2 (PB1) 3729.5 0.000000e+00 2190/2275 (96%)
EPI500932 A/Duck/Fujian/S4081/2008 (A/H6N2) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI401343 A/wild duck/Korea/SH5-26/2008 (A/H4N6) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI315129 A/duck/Vietnam/G30/2008 (A/H11N9) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI314537 A/avian/Japan/8KI0184/2008 (A/H4N6) segment 2 (PB1) 3729.5 0.000000e+00 2190/2275 (96%)
EPI299288 A/avian/Japan/8KI0135/2008 (A/H6N5) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI299264 A/avian/Japan/8KI0185/2008 (A/H4N6) segment 2 (PB1) 3729.5 0.000000e+00 2190/2275 (96%)
EPI229995 A/mallard/France/061054/2006 (A/H5N3) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI180837 A/duck/Laos/P0161/2007 (A/H5N1) segment 2 (PB1) 3729.5 0.000000e+00 2190/2275 (96%)
EPI169281 A/duck/France/061054/2006 (A/H5N3) segment 2 (PB1) 3729.5 0.000000e+00 2189/2274 (96%)
EPI221977 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 2 (PB1) 3727.7 0.000000e+00 2188/2273 (96%)
EPI221969 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 2 (PB1) 3727.7 0.000000e+00 2188/2273 (96%)
EPI221961 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 2 (PB1) 3727.7 0.000000e+00 2188/2273 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:58 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
3 2233 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (AIGoose1Taiwanl0103l2015( H5N8)) polymerase PA (PA) gene, complete eds).
ACCESSION VERSION KEYWORDS
SOURCE Viru ses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
ORGAN ISM Viruses; ssRNA negative-strand viruses; Orthomyxov iridae ; Influenzavirus A.
Unclassified .
REFERENCE 1 (bases 1 to 2233 )

AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

Lee,M.S. , Chen , L.H. , Liu,Y .P ., Chen ,Y.P. , Li,W .C. , Lee , F. ,
Ting , L.J. and Lin , Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 2233)
Lee,M. S ., Chen, L.H. , Liu,Y. P. , Chen , Y. P. , Li,W. C. , Lee,F. ,

Ting,L.J. and Lin, Y.L. TITLE Direct Submission
JOURNAL Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung -Cheng Rd, Tansui, Taiwan 251, Taiwan
COMMENT ##Metadata -START##
Sequencing Technology : : Sanger dideoxy sequencing
##Metadata-END##
FEATURES Location/Qualifiers source l . .2233
/organism= "Viruses ; ssRNA negative-strand viruses;
Orthomy xov iridae; Influenzavirus A ."
/mol type= "mRNA "
/str in= "A/Goose/Taiwan/010 3/2015 "
/isolation_source= "organ "
/host= "goose "
/segment= " 3"
/country= "Taiwan"
/collection_date= " 2015- 0l- 09 "
/identified_by= "RT-PCR"
/subtype= "H5N8"

gene CDS

1. . 2233
/gene= "PA" 25 . .2175
/gene= "PA"
/codon start=l
/translation= "MEDFVRQCFNPMIVELAEKTMKEYGENPKIETNKFAAICT HLEV CFMYSDFHFIDERGKSIIVESGDPNAL LKHRFEIIEGRDRTMAWTVVNS ICNTTGVDK PKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKPEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTR LFTIRQEMANRGLWDSFRQSERGEETIEERFEITG TMRRLANQS LPPNFSSLENFRAYVDGFKPNGCLEGKLSQM SKEVNARIEPFMKTTPRPLRLPDGPPC SQRSKFLLMDSLKLSIED PSHEGEGIPLYDA IKCMKTFFGWKEPNIVKPHVKGINPNY LLAWKQVLAELQDIENEETIPKTK.NMKKTSQLKWALGENMAPEKVDFEDCRDVSDLRQ YDSDEPEPRSLSS WIQSEFN KACELTDSSW IELDEIGEDVAPIEHIASMRR NYFTAEV SHCRATEYIMKGVY INTALLNSSCAAMDDFQLIPMISKCRTKEGRRKT NLYGFIIKGR SHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVSRS MFLYVR TNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGES PKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQAFRDNLEPGTFD LGGLYEAIEECLINDPWVLLNASWFNSFLTHALK "

gene 25 ..784
/gene= "PA-X "
CDS 25 . .784
/gene= "PA-X "
/codon start=l
/product= "PA-X protein"
/translation= "MEDFVRQCFNPMI VELAEKTMKEYGENPKIETNKFAAICTHLEV CFMYSDFHFIDERGKS IIVESGDPNALLKHRFEI IEGRDRTMAWTVVNSICNTTGVDK PKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKPEKT HIHIFSFTGEEMATKAD YTLDEESRARIKTRLF TIRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLANQS LPPNFSSLENFRAYVDGFKPNGCLEGKLSQMSKEV "
BASE COUNT 746 a 435 c 519 g 533 t ORIGIN
1 agcaaaagca ggtactgatc caaaatggaa gactttgtgc ggcaatgctt caatccaatg
61 atcgtcgagc ttgcggaaaa gacaatgaaa gaatatgggg aaaatccaaa aatcgaaacg
121 aacaaattcg ctgcaatatg cactcactta gaggtctgtt tcatgtattc ggatttccac
181 tttattgatg aacgaggcaa atcaataatt gtagaatctg gcgatccgaa tgcattattg
241 aaacaccgat ttgagataat tgaagggaga gaccgaacga tggcttggac agtggtaaat
301 agtatctgca acaccacagg agtcgataag cctaaattcc tcccagattt gtatgattac
361 aaggagaacc gattcattga aattggagtg acaaggaggg aagttcacac atactaccta
421 gaaaaggcaa ataagataaa accagagaag acacacattc acatattctc attcactggg
481 gaggagatgg ccaccaaagc tgactatacc cttgatgaag agagcagagc aaggatcaaa
541 accaggttgt tcactatcag gcaagaaatg gccaataggg gtctgtggga ttcctttcgt 601 caatctgaga gaggcgaaga gacaattgaa gaaaggtttg aaatcacagg aaccatgcgc 661 aggcttgcca accaaagcct cccaccgaat ttctccagcc ttgaaaattt tagagcctat 721 gtggatggat tcaaaccgaa cggctgcctt gagggcaagc tttctcaaat gtcaaaagaa 781 gtgaacgcca gaattgagcc attcatgaag acaacaccac gccctctcag attacctgat 841 ggtcctcctt gctctcagcg gtcgaaattc ttactgatgg attcccttaa attgagcatc 901 gaagacccaa gccatgaggg agaaggtata ccgctatatg atgcaatcaa atgcatgaag 961 acgttttttg gttggaaaga gcccaacatt gtaaaaccac atgtaaaagg cataaatccc 1021 aactatctct tggcttggaa gcaggtgctg gcagaactcc aagacattga gaatgaagag 1081 acaatcccaa aaacaaaaaa catgaagaaa acaagccaac taaagtgggc actcggtgag 1141 aatatggcac ctgaaaaagt ggactttgag gactgcagag atgttagcga tctaagacag 1201 tatgacagtg atgaaccaga gcccagatca ttatcaagct ggatccagag cgaattcaac 1261 aaagcatgcg aattgacaga ttcgagttgg attgaacttg atgaaatagg agaagatgtt 1321 gctccaattg agcacattgc gagtatgaga agaaactact tcacagcgga agtgtctcat 1381 tgcagggcaa ctgaatatat aatgaaagga gtttatataa atacagccct gttgaattca

1441 tcctgtgcag ccatggatga cttccaattg attccaatga taagcaagtg cagaaccaaa 1501 gaaggaagac ggaagacaaa tttatatggg ttcattataa aaggaagatc ccatttgagg 1561 aatgataccg atgtggtaaa ttttgtgagc atggagttct ccctcactga cccgaggctg 1621 gaaccacaca agtgggaaaa gtactgtgtt ctcgaaatag gagacatgct cctacgaact 1681 gcaataggcc aagtatcaag atccatgttt ctttatgtaa gaaccaatgg gacttccaag 1741 atcaagatga aatggggcat ggagatgagg cgatgccttc ttcaatccct ccaacaaatt 1801 gagagcatga ttgaggcaga gtcttctgtc aaagagaaag acatgaccaa ggaattcttt 1861 gaaaataaat cagaaacgtg gccaattggg gaatcaccta agggggtgga ggaaagctct 1921 attgggaagg tgtgtagaac attattagca aaatctgtat tcaacagcct atatgcatct 1981 ccacaacttg aggggttttc agctgagtcg agaaagttac ttctcattgt tcaggcattt 2041 agggacaacc tggaacctgg gaccttcgat cttggggggc tatatgaagc aattgaggag 2101 tgcctgatta atgatccctg ggttttgctt aatgcatctt ggttcaactc cttccttaca 2161 catgcactga aatagttgtg gcaatgctac tatttgctat ccatactgtc caaaaaagta 2221 ccttgtttct act

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:00 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2130/2148 (99%)
EPI558010 A/duck/England/36038/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI558003 A/duck/England/36226/14 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3790.4 0.000000e+00 2099/2122 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3762.7 0.000000e+00 2091/2118 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3755.4 0.000000e+00 2085/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2081/2152 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3546.7 0.000000e+00 2074/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3513.4 0.000000e+00 2068/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3507.9 0.000000e+00 2068/2152 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2066/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3480.2 0.000000e+00 2064/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3447.0 0.000000e+00 2058/2153 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI509692 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 3 (PA) 3430.3 0.000000e+00 2055/2153 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3430.3 0.000000e+00 2055/2153 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170596 A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI139938 A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113068 A/duck/Guangxi/5165/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113064 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113060 A/goose/Guangxi/4513/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:02 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
5 1565 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0103/2015(H5N8)) nucleocapsid protein (NP) gene, complete eds].
ACCESSION VERSION KEYWORDS
SOURCE Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A .
ORGANISM Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A.
Unclassified.
REFERENCE 1 (bases 1 to 1565)
AUTHORS Lee,M.S. , Chen,L.H. , Liu , Y.P. , Chen,Y.P. , Li,W. C. , Lee, F .,
Ting, L.J. and Lin , Y.L.
TITLE Avian influenza subtype HS in geese in Taiwan , 2015 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1565)
AUTHORS Lee,M.S. , Chen,L .H . , Liu,Y.P. , Chen ,Y.P. , Li,W. C. , Lee, F. ,
Ting,L.J. and Lin,Y.L. TITLE Direct Submission
JOURNAL Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung-Cheng Rd, Tansui , Taiwan 251, Taiwan
COMMENT ##Metadata-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Metadata-END##
FEATURES Location/Qualifiers source 1 . . 1565
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA"
/strain= "A/Goose/Taiwan/0103/2015 "
/isolation_source= "organ "
/host= "goose "
/segment= " 5 "
/country= "Taiwan"
/collection_date= "2015- 01-09 "
/identified by= "RT-PCR "
/subtype= "H5N8 "

gene CDS











BASE COUNT ORIGIN

1 . .1565
/gene= "NP" 46 . .1542
/gene= "NP"
/codon_start=l
/product= "nucleocapsid protein"
/translation= "MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMC TELKLSDYEGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRRDG KWMRELILYDKEEIRRIWRQANNGEDATTGLTHLMIWHSNLNDATYQRTRALVRTGMD PRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIA YERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCL PACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACH SAAFEDLRVSSFIRGTRVVPRGQLSTRGVQIASNENMETIDSSTLELRSRYWAIRTRS GGNTNQQRASAGQISVQPTFSVQRNLPFERATIMAAFTGNTEGRTSDMRTEIIRMMES ARPEDVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN "
498 a 319 c 420 g 328 t

1 agcaaaagca gggtagataa tcactcactg agtgacatca acatcatggc gtctcaaggc
61 accaaacgat cttatgaaca aatggaaact ggtggagaac gccagaatgc cactgaaatc

121
181
241

agagcatctg ttggaaggat ggttggtgga attgggaggt tttacataca gatgtgcact gaactcaaac tcagcgacta tgaagggagg ctgatccaga acagcataac aatagagaga atggttctct ctgcatttga tgaaaggagg aacaaatacc tggaagaaca tcccagtgct

301
361
421
481
541

gggaaggatc cgaagaaaac tggaggtcca atttatcgaa gaagggacgg gaaatggatg agagagctga ttctgtatga caaagaggag atcaggagaa tctggcgtca agcgaacaat ggagaggacg caactactgg tctcactcac ctgatgatct ggcattccaa tctaaatgat gccacatacc agagaaccag agctctcgtg cgcactggga tggaccccag aatgtgctct ctgatgcaag gatcaactct cccgaggaga tctggagctg ctggcgcagc agtaaagggt

601 gtcgggacga tggtgatgga actaattcgg atgataaaac gagggattaa tgatcggaat

661
721
781
841

ttctggagag gcgaaaatgg acggagaaca aggattgcat atgagaggat gtgcaacatc ctcaaaggga aattccaaac agcagcacaa agagcaatga tggaccaagt gcgagaaagc agaaatcctg ggaatgctga aattgaagat ctcatcttcc tggcacggtc agcactcatc ctgagaggat cagtggccca taagtcttgc cttcctgctt gtgtgtacgg gcttgctgtg

901 gccagtggat atgactttga gagagaaggg tactctctag ttggaataga tcctttccgt










I I
LOCUS

961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561

ctgcttcaga acagccaggt cttcagtctc atcagaccaa atgagaaccc agcacacaag agtcaattgg tgtggatggc atgccattct gcagcatttg aggacctgag agtctcaagt ttcatcagag ggacaagagt ggtcccaaga ggacaactat ccaccagagg agttcaaatt gcttcaaatg agaacatgga aacaatagac tccagcactc ttgaactgag gagcaggtat tgggctataa ggaccaggag tggaggaaac accaatcaac agagagcatc tgcaggacag atcagtgtac agcctacttt ctcagtacag agaaatcttc ccttcgaaag agcaaccatc atggcggcgt tcacaggaaa tactgaaggc agaacatctg acatgaggac tgaaatcata agaatgatgg aaagtgccag accagaagat gtgtccttcc aggggcgggg agtcttcgag ctctcggacg aaaaggcaac gaacccgatc gtgccttcct ttgacatgag taatgaagga tcttatttct tcggagacaa tgcagaggag tatgacaatt aaagaaaaat acccttgttt ctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:09 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI438282 A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI470398 A/wild waterfowl/Hong Kong/MPP1311/2013 (A/H2N9) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI470437 A/common teal/Hong Kong/MPM1670/2011 (A/H7N7) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI470442 A/wild waterfowl/Hong Kong/MPL1006/2011 (A/H7N7) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI470441 A/wild waterfowl/Hong Kong/MPM2121/2011 (A/H7N7) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI470440 A/wild waterfowl/Hong Kong/MPL705/2011 (A/H7N7) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI470438 A/common teal/Hong Kong/MPL634/2011 (A/H7N7) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI470436 A/common teal/Hong Kong/MPM1645/2011 (A/H7N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI470411 A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI493029 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI470439 A/common teal/Hong Kong/MPM1740/2011 (A/H7N7) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI446508 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 5 (NP) 2617.8 0.000000e+00 1470/1497 (98%)
EPI470431 A/wild waterfowl/Hong Kong/MPL696/2011 (A/H2N9) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI470377 A/wild duck/Jiangxi/19831/2009 (A/H7N7) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI510819 A/duck/Taiwan/11213/2013 (A/H5N2) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI470380 A/duck/Jiangxi/23008/2009 (A/H7N7) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI461630 A/duck/Hunan/S1256/2012 (A/H3N8) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI392508 A/pintail/Korea/1173/09 (A/H7N7) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI407865 A/Khaki Campbell duck/Karachi/NARC-23963/2010 (A/H4N6) segment 5 (NP) 2606.7 0.000000e+00 1468/1497 (98%)
EPI510826 A/duck/Taiwan/11254/2013 (A/H5N2) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI470443 A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI470378 A/duck/Jiangxi/21669/2009 (A/H7N7) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI387852 A/wild bird/Korea/A02/2011 (A/H10N4) segment 5 (NP) 2582.7 0.000000e+00 1465/1498 (97%)
EPI441047 A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI387853 A/wild bird/Korea/A01/2011 (A/H10N4) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI315101 A/mallard/PT/27972-B139/2007 (A/H9N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI363536 A/duck/Guizhou/2773/2006 (A/H6N2) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI470415 A/duck/Yunnan/87/2007 (A/H7N6) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI515143 A/duck/Vietnam/LBM533/2013 (A/H3N6) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI316769 A/mallard/Czech Republic/13579-84K/2010 (A/H4N6) segment 5 (NP) 2556.9 0.000000e+00 1459/1497 (97%)
EPI270063 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI268706 A/mallard/Jiangxi/7376/2003 (A/H6N2) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI222088 A/garganey/Altai/1213/2007 (A/H5N2) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI222048 A/gadwall/Altai/1202/2007 (A/H5N2) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI168528 A/mute swan/Aktau/1460/2006 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1434/1461 (98%)
EPI506050 A/duck/Moscow/4182/2010 (A/H5N3) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI372497 A/mallard/Ukraine/05842-NAMRU3/2006 (A/H3N8) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI387854 A/mallard/Korea/1203/2010 (A/H10N8) segment 5 (NP) 2540.3 0.000000e+00 1431/1459 (98%)
EPI251701 A/mallard/Sweden/4/2002 (A/H10N2) segment 5 (NP) 2540.3 0.000000e+00 1456/1497 (97%)
EPI342610 A/swan/Czech Republic/5416/2011 (A/H7N7) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI1744 A/duck/Hokkaido/9/99 (A/H9N2) segment 5 (NP) 2532.9 0.000000e+00 1456/1498 (97%)
EPI316865 A/mallard/Czech Republic/14924-1/2007 (A/H6N5) segment 5 (NP) 2529.2 0.000000e+00 1454/1497 (97%)
EPI451162 A/mallard/Netherlands/10-Cam/1999 (A/H1N1) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI451128 A/mallard/Netherlands/10-Nmkt/1999 (A/H0) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI372403 A/shoveler/Egypt/00215-NAMRU3/2007 (A/H7N9) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI251641 A/mallard/Netherlands/10/1999 (A/H1N8) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI463223 A/mallard/Sweden/100546/2009 (A/H8N4) segment 5 (NP) 2520.0 0.000000e+00 1438/1475 (97%)
EPI314542 A/avian/Japan/8KI0148/2008 (A/H4N2) segment 5 (NP) 2516.3 0.000000e+00 1453/1498 (96%)
EPI284622 A/duck/Hunan/8-19/2009 (A/H4N2) segment 5 (NP) 2516.3 0.000000e+00 1453/1498 (96%)
EPI140252 A/migratory duck/Jiang Xi/6568/2004 (A/H4N6) segment 5 (NP) 2516.3 0.000000e+00 1453/1498 (96%)
EPI127027 A/aquatic bird/Korea/JN-1/2005 (A/H3N8) segment 5 (NP) 2516.3 0.000000e+00 1449/1492 (97%)
EPI463263 A/mallard/Sweden/107892/2009 (A/H2N3) segment 5 (NP) 2514.4 0.000000e+00 1437/1475 (97%)
EPI401315 A/wild bird/Korea/GD42/2005 (A/H4N6) segment 5 (NP) 2510.7 0.000000e+00 1451/1497 (96%)
EPI326909 A/environment/Korea/KCA16/2004 (A/H3N8) segment 5 (NP) 2510.7 0.000000e+00 1446/1489 (97%)
EPI314248 A/wild duck/Taiwan/WB499/2004 (A/H4N6) segment 5 (NP) 2507.0 0.000000e+00 1433/1471 (97%)
EPI526129 A/common shelduck/Mongolia/2076/2011 (A/H3N8) segment 5 (NP) 2494.1 0.000000e+00 1394/1416 (98%)
EPI508109 A/bean goose/Korea/SH20-17/2008 (A/H7N3) segment 5 (NP) 2488.6 0.000000e+00 1444/1492 (96%)
EPI251859 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 5 (NP) 2488.6 0.000000e+00 1448/1498 (96%)
EPI251662 A/mallard/Netherlands/2/1999 (A/H3N5) segment 5 (NP) 2488.6 0.000000e+00 1448/1498 (96%)
EPI251618 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 5 (NP) 2488.6 0.000000e+00 1448/1498 (96%)
EPI526100 A/common teal/Mongolia/2273/2011 (A/H6N6) segment 5 (NP) 2484.9 0.000000e+00 1389/1411 (98%)
EPI514048 A/mallard/Sweden/68504/2007 (A/H4N2) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI118126 A/Chicken/Italy/9097/97 (A/H5N9) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI89042 A/Pigeon/Nanchang/8-142/2000 (A/H3N6) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI63189 A/chicken/Italy/22A/1998 (A/H5N9) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI256872 A/mallard/Poland/446/09 (A/H7N7) segment 5 (NP) 2481.2 0.000000e+00 1419/1457 (97%)
EPI514024 A/mallard/Sweden/68571/2007 (A/H4N6) segment 5 (NP) 2477.5 0.000000e+00 1446/1498 (96%)
EPI514001 A/mallard/Sweden/68940/2007 (A/H4N2) segment 5 (NP) 2477.5 0.000000e+00 1446/1498 (96%)
EPI513966 A/mallard/Sweden/68677/2007 (A/H0) segment 5 (NP) 2477.5 0.000000e+00 1446/1498 (96%)
EPI377603 A/mallard/Sweden/68597/2007 (A/H2N2) segment 5 (NP) 2477.5 0.000000e+00 1446/1498 (96%)
EPI377595 A/mallard/Sweden/68735/2007 (A/H2N2) segment 5 (NP) 2477.5 0.000000e+00 1446/1498 (96%)
EPI533780 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI533774 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI514010 A/mallard/Sweden/68551/2007 (A/H4N2) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI513973 A/mallard/Sweden/68761/2007 (A/H4N6) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI513928 A/mallard/Sweden/69580/2007 (A/H0) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI248494 A/mallard/Germany-RP/R193/09 (A/H1N1) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI243273 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI1652 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 5 (NP) 2471.9 0.000000e+00 1445/1498 (96%)
EPI514031 A/mallard/Sweden/68575/2007 (A/H4N6) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI513987 A/mallard/Sweden/68893/2007 (A/H4N6) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI513980 A/mallard/Sweden/68836/2007 (A/H4N6) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI363924 A/duck/Guizhou/1088/2007 (A/H6N2) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI251714 A/mallard/Sweden/45/2002 (A/H11N8) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI89049 A/Duck/Nanchang/8-174/2000 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI7440 A/Duck/Hong Kong/P185/97 (A/H3N8) segment 5 (NP) 2466.4 0.000000e+00 1445/1499 (96%)
EPI7438 A/Aquatic Bird/Hong Kong/m603/98 (A/H11N1) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI3409 A/duck/Mongolia/54/01 (A/H5N2) segment 5 (NP) 2466.4 0.000000e+00 1444/1498 (96%)
EPI545218 A/Seal/Sweden/SVA0546/2014 (A/H10N7) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI544352 A/harbour seal/Germany/1/2014 (A/H10N7) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI514915 A/mallard/Sweden/274/2002 (A/H4N2) segment 5 (NP) 2460.9 0.000000e+00 1443/1498 (96%)
EPI439828 A/domestic green-winged teal/Hunan/2036/2007 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1443/1498 (96%)
EPI251626 A/mallard/Netherlands/1/1999 (A/H4N6) segment 5 (NP) 2460.9 0.000000e+00 1443/1498 (96%)
EPI190327 A/mallard/Netherlands/29/2006 (A/H7N2) segment 5 (NP) 2460.9 0.000000e+00 1443/1498 (96%)
EPI174814 A/mallard/Denmark/77-64650-G10/2005 (A/H1N1) segment 5 (NP) 2460.9 0.000000e+00 1443/1498 (96%)
EPI313964 A/duck/Taiwan/445/2006 (A/H4N8) segment 5 (NP) 2457.2 0.000000e+00 1424/1471 (96%)
EPI485637 A/mallard/Sweden/91/2002 (A/H7N9) segment 5 (NP) 2455.3 0.000000e+00 1442/1498 (96%)
EPI398947 A/mallard/Norway/10_779/2009 (A/H3N8) segment 5 (NP) 2455.3 0.000000e+00 1442/1498 (96%)
EPI377626 A/mallard/Netherlands/14/2007 (A/H2N2) segment 5 (NP) 2455.3 0.000000e+00 1442/1498 (96%)
EPI268670 A/duck/Hunan/908/2005 (A/H6N2) segment 5 (NP) 2455.3 0.000000e+00 1442/1498 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:11 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
8 890 bp mRNA linear 10-FEB- 2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0103/2015(H5N8)) nuclear export protein (NEP) and nonstructural protein 1 (NSl) genes, complete eds].

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene CDS




V iruses; ssRNA negative -strand viruses; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative -strand viruses; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
1 (bases 1 to 890)
Lee , M.S. , Chen,L.H. , Liu,Y.P ., Chen,Y .P. , Li,W .C . , Lee , F. ,
Ting , L .J . and Lin,Y.L .
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 890)
Lee,M.S. , Chen,L .H., Liu,Y.P. , Chen,Y.P. , Li,W.C ., Lee, F. ,
Ting,L.J . and Lin , Y.L. Direct Subm ission
Submi tted (10-FEB-2015) Epidemiology Research Department , National Institute for Animal Health, Chung-Cheng Rd, Tansui, Taiwan 251, Taiwan
##Metadata-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Metadata-END##
Location/Qualifiers
l. . 890
/organism= "Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/0103/2015"
/isolation source= "organ "
/host= "goose"
/segment="8 "
/country= "Taiwan "
/collection date= "2015- 01-09 "
/identified=by= "RT-PCR "
/subtype= "H5N8 " 27 . .864
/gene= "NEP " join(27 . .56,529 ..864)
/gene= "NEP "






gene CDS

/codon start=l
/product= "nuclear export protein"
/translation="MDSNTVSSFQDILMRMSKLQLGSSSEGLNGMITQFESLKLYRDS LGEAVMRMGDLHSLQNRNGKWREQLSQKFEEIRWLIEEMRHRLKTTENSFEQITFMQA LQLLLEVEQEIRTFSFQLI"
27 ..740
/gene= "NSl " 27 . .740
/gene= "NSl "
/codon start=l
/product= "nonstructural protein l "
/translation= "MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLR GRGSTLGLDIETATRAGKQIVERILGEESDEALKMNIASVPTSRYLTDMTLEEMSRDW FMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEI SPLPSLPGHTDEDVKIAIGVLIGGLEWNDNTVRVSETLQRFTWRSSNEDGRPSLPSKQ KRKMARTIESEVRGNKMAD"

BASE COUNT 290 a 180 c 207 g 213 t ORIGIN
1 agcaaaagca gggtgacaaa aacataatgg actccaacac tgtgtcaagc tttcaggtag
61 actgctttct ttggcatgtc cgcaaacgat ttgcagacca agaactgggt gatgccccat
121 tccttgaccg gcttcgccga gaccagaagt ccctaagagg aagaggcagc actcttggtc
181 tggacatcga gacagctact cgtgcgggaa agcaaatagt ggagcggatt ctgggggaag
241 aatctgatga agcacttaaa atgaatattg cttctgtacc gacttcacgc tacctaactg
301 acatgactct tgaagaaatg tcaagagact ggttcatgct catgcccaag cagaaagtag
361 caggttctct ctgcatcaaa atggaccagg caataatgga taaaaccatc atactgaaag
421 caaatttcag tgtgattttt gatcggctgg aaaccctaat attacttaga gctttcacag
481 aagaaggagc aattgtggga gaaatctcac cattaccttc tcttccagga catactgatg
541 aggatgtcaa aattgcaatt ggggtcctca tcggagggct tgaatggaat gataacacag 601 ttcgagtctc tgaaactcta cagagattca cttggagaag cagtaatgag gatgggagac 661 cttcactccc ttcaaaacag aaacggaaaa tggcgagaac aattgagtca gaagttcgag 721 gaaataagat ggctgattga ggaaatgcga catagattga agaccacaga gaacagcttc 781 gaacaaataa cgtttatgca agctttacaa ctattgcttg aagtggagca agagataaga 841 accttctcgt ttcagcttat ttaatgataa aaaacaccct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 833/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 828/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 827/835 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 811/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 810/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 821/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 825/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1461.8 0.000000e+00 797/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 813/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1417.5 0.000000e+00 813/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1393.5 0.000000e+00 766/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1354.7 0.000000e+00 797/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI470704 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI470665 A/eurasian wigeon/Hong Kong/MPK653/2009 (A/H11N9) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI470656 A/eurasian wigeon/Hong Kong/MPK655/2009 (A/H11N9) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI268611 A/duck/Shantou/728/2001 (A/H6N2) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 5:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A/goose/Taiwan/a015/2015 at GISAID

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 2:12 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI588952 A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI588968 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI588976 A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI588960 A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%)
EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3061.0 0.000000e+00 1688/1704 (99%)
EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI587633 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI587521 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1683/1705 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI585588 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI585585 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI585578 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1679/1704 (98%)
EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1679/1704 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1670/1704 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 2:19 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI588954 A/goose/Taiwan/a015/2015 (A/H5N8) segment 6 (NA) 2597.5 0.000000e+00 1406/1406 (100%)
EPI588978 A/duck/Taiwan/a068/2015 (A/H5N8) segment 6 (NA) 2592.0 0.000000e+00 1405/1406 (99%)
EPI573640 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI587523 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI553210 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI569378 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 6 (NA) 2525.5 0.000000e+00 1393/1406 (99%)
EPI569374 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 6 (NA) 2525.5 0.000000e+00 1393/1406 (99%)
EPI569392 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 6 (NA) 2514.4 0.000000e+00 1391/1406 (98%)
EPI585086 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 6 (NA) 2503.3 0.000000e+00 1389/1406 (98%)
EPI561669 A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA) 2503.3 0.000000e+00 1389/1406 (98%)
EPI561544 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA) 2503.3 0.000000e+00 1389/1406 (98%)
EPI585633 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585632 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585630 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585629 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585628 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585626 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585624 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585623 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585620 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585619 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585617 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585616 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561676 A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561662 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561655 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561648 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561635 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561628 A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561621 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561614 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561579 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561510 A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561362 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561355 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561350 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561343 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561209 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI561198 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI509714 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI509706 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA) 2497.8 0.000000e+00 1388/1406 (98%)
EPI585627 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI585625 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI585622 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561707 A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561699 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561683 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561607 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561600 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1388/1407 (98%)
EPI561593 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561572 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561565 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561558 A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561551 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561531 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561524 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI561517 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI553345 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1387/1406 (98%)
EPI585631 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI585621 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI585618 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI585615 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI561692 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI561189 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI542632 A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA) 2486.7 0.000000e+00 1386/1406 (98%)
EPI552748 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 6 (NA) 2481.2 0.000000e+00 1385/1406 (98%)
EPI544759 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA) 2481.2 0.000000e+00 1385/1406 (98%)
EPI543012 A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA) 2481.2 0.000000e+00 1385/1406 (98%)
EPI517163 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA) 2481.2 0.000000e+00 1385/1406 (98%)
EPI573655 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 6 (NA) 2475.6 0.000000e+00 1384/1406 (98%)
EPI573648 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 6 (NA) 2475.6 0.000000e+00 1384/1406 (98%)
EPI558000 A/duck/England/36226/14 (A/H5N8) segment 6 (NA) 2475.6 0.000000e+00 1384/1406 (98%)
EPI543004 A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA) 2475.6 0.000000e+00 1384/1406 (98%)
EPI573682 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI573674 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI573666 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI558007 A/duck/England/36038/14 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI553364 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI553350 A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI548495 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI548487 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI547683 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA) 2470.1 0.000000e+00 1383/1406 (98%)
EPI548626 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA) 2464.6 0.000000e+00 1382/1406 (98%)
EPI553152 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA) 2459.0 0.000000e+00 1382/1407 (98%)
EPI547675 A/duck/England/36254/14 (A/H5N8) segment 6 (NA) 2459.0 0.000000e+00 1381/1406 (98%)
EPI555122 A/mallard/Germany-ST/R23/2015 (A/H5N8) segment 6 (NA) 2453.5 0.000000e+00 1380/1406 (98%)
EPI554606 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 6 (NA) 2453.5 0.000000e+00 1381/1407 (98%)
EPI555068 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 6 (NA) 2438.7 0.000000e+00 1376/1405 (97%)
EPI551150 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2431.3 0.000000e+00 1362/1385 (98%)
EPI552778 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 6 (NA) 2423.9 0.000000e+00 1358/1381 (98%)
EPI552770 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2422.1 0.000000e+00 1357/1380 (98%)
EPI552762 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2416.5 0.000000e+00 1354/1377 (98%)
EPI551144 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2416.5 0.000000e+00 1354/1377 (98%)
EPI585113 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 6 (NA) 2409.2 0.000000e+00 1352/1376 (98%)
EPI542627 A/duck/Beijing/FS01/2013 (A/H5N8) segment 6 (NA) 2405.5 0.000000e+00 1356/1385 (97%)
EPI530990 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 6 (NA) 2348.2 0.000000e+00 1362/1407 (96%)
EPI530989 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 6 (NA) 2342.7 0.000000e+00 1361/1407 (96%)
EPI561493 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 6 (NA) 2337.1 0.000000e+00 1360/1407 (96%)
EPI544894 A/duck/Shandong/Q1/2013 (A/H5N8) segment 6 (NA) 2337.1 0.000000e+00 1360/1407 (96%)
EPI509700 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 6 (NA) 2337.1 0.000000e+00 1360/1407 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page Previous  1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 73 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group