Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 7:08 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Fri Feb 06, 2015 11:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
GISAID has updated database with H5N8 sequences (clade 2.3.4.4) from early 2014 outbreak in South Korea.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 11:28 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A/spot-billed duck/Korea/H455-42/2014
EPI_ISL_171720
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-02-08


A/common teal/Korea/H455-30/2014
EPI_ISL_171719
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-02-08


A/tundra swan/Korea/H411/2014
EPI_ISL_171718
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-02-06


A/bean goose/Korea/H328/2014
EPI_ISL_171717
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-02-01


A/mallard/Korea/H297/2014
EPI_ISL_171716
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-29


A/Korean native chicken/Korea/H257/2014
EPI_ISL_171715
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-28


A/breeder chicken/Korea/H250/2014
EPI_ISL_171714
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-28


A/breeder duck/Korea/H249/2014
EPI_ISL_171713
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-28


A/white-fronted goose/Korea/H231/2014
EPI_ISL_171712
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-28


A/mallard/Korea/H207/2014
EPI_ISL_171711
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-27


A/breeder duck/Korea/H200/2014
EPI_ISL_171710
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-27


A/breeder duck/Korea/H158/2014
EPI_ISL_171709
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-26


A/broiler duck/Korea/H145/2014
EPI_ISL_171708
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-25


A/broiler duck/Korea/H133/2014
EPI_ISL_171707
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-25


A/breeder duck/Korea/H128/2014
EPI_ISL_171706
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-25


A/breeder chicken/Korea/H122/2014
EPI_ISL_171705
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-24


A/Baikal teal/Korea/H96/2014
EPI_ISL_171704
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-23


A/Baikal teal/Korea/H84/2014
EPI_ISL_171703
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-22


A/Coot/Korea/H81/2014
EPI_ISL_171702
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-22


A/Baikal teal/Korea/H80/2014
EPI_ISL_171701
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-22


A/Baikal teal/Korea/H68/2014
EPI_ISL_171700
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-22


A/Baikal teal/Korea/H66/2014
EPI_ISL_171699
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-21


A/broiler duck/Korea/H65/2014
EPI_ISL_171698
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-21


A/Baikal teal/Korea/H62/2014
EPI_ISL_171697
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-21


A/bean goose/Korea/H53/2014
EPI_ISL_171696
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-20


A/Baikal teal/Korea/H52/2014
EPI_ISL_171695
H5N8
2308
2310
2200
1742
1529
1424
992
855
---
---
2014-01-20


A/bean goose/Korea/H40/2014
EPI_ISL_171678
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-19


A/broiler duck/Korea/H49/2014
EPI_ISL_171677
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-20


A/broiler duck/Korea/H48/2014
EPI_ISL_171676
H5N8
2308
2309
2200
1742
1529
1424
992
855
---
---
2014-01-20


A/broiler duck/Korea/H47/2014
EPI_ISL_171675
H5N8
2308
2309
2200
1742
1529
1425
992
855
---
---
2014-01-20


A/Baikal teal/Korea/H41/2014
EPI_ISL_171674
H5N8
2308
2309
2200
1742
1534
1424
992
855
---
---
2014-01-19


A/broiler duck/Korea/H31/2014
EPI_ISL_171657
H5N8
2308
2309
2200
1742
1534
1425
992
855
---
---
2014-01-19


A/broiler duck/Korea/H29/2014
EPI_ISL_171656
H5N8
2308
2309
2200
1742
1534
1425
992
855
---
---
2014-01-18


A/waterfowl/Korea/S005/2014
EPI_ISL_171655
H5N8
2311
2311
2203
1746
1535
1431
997
860
---
---
2014-02-15

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 11:29 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP307957 1704 bp cRNA linear VRL 21-JAN-2015
DEFINITION Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP307957
VERSION KP307957.1 GI:748113758
KEYWORDS .
SOURCE Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
ORGANISM Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T., Handel,K.
and Alexandersen,S.
TITLE Reassortant highly pathogenic Influenza A (H5N2) virus containing
Eurasian lineage H5 and four other gene segments from Eurasian H5N8
in Canada, 2014
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T.,
Suderman,M., Cottam-Birt,C., Handel,K. and Alexandersen,S.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-2014) Canadian Food Inspection Agency, National
Centre for Foreign Animal Disease, 1015 Arlington Street, Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers KP307954-KP307961 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNASTAR Lasergene v. 12
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/BC/FAV10/2014"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1589326"
/segment="4"
/country="Canada"
/collection_date="02-Dec-2014"
/note="passage details: 1CE-3dpi"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJE30360.1"
/db_xref="GI:748113759"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct ttttgcagtg attagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
241 ccaatgtgcg acgagttcat cagggtaccg gaatggtctt acatcgtgga gagggctaac
301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgttgg gacatcaaca
661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcagagtgga
721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatcaaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgacaaagt ccgactacag cttagggata atgcaaagga gctgggtaat
1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
1561 gtgaaattag aatcaatagg aacttaccag atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
1681 ttacaatgca gaatttgcat ctaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 11:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1690/1706 (99%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1666/1693 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1656/1684 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1662/1693 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1628/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2911.4 0.000000e+00 1638/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2854.2 0.000000e+00 1588/1609 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1588/1612 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1587/1610 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1584/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1651/1708 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2826.5 0.000000e+00 1651/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1645/1710 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1644/1709 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1642/1709 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2760.0 0.000000e+00 1638/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1640/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1638/1709 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1636/1709 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1524/1546 (98%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1633/1709 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2717.5 0.000000e+00 1631/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2699.1 0.000000e+00 1630/1711 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2665.8 0.000000e+00 1622/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2632.6 0.000000e+00 1618/1711 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1617/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2588.3 0.000000e+00 1608/1709 (94%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2568.0 0.000000e+00 1607/1712 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2516.3 0.000000e+00 1595/1709 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1593/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1594/1709 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2508.9 0.000000e+00 1594/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2505.2 0.000000e+00 1594/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1586/1700 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 11:39 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 977/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1722.2 0.000000e+00 948/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1683.4 0.000000e+00 913/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 959/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 909/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 953/979 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 12:05 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4091.4 0.000000e+00 2255/2277 (99%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4082.2 0.000000e+00 2252/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2235/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2234/2256 (99%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 4002.8 0.000000e+00 2205/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3993.6 0.000000e+00 2204/2225 (99%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3984.3 0.000000e+00 2229/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2233/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3884.6 0.000000e+00 2222/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3801.5 0.000000e+00 2206/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3796.0 0.000000e+00 2092/2111 (99%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3707.3 0.000000e+00 2190/2281 (96%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3701.8 0.000000e+00 2188/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3663.0 0.000000e+00 2182/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3613.2 0.000000e+00 2174/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3613.2 0.000000e+00 2169/2275 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3592.9 0.000000e+00 2169/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3585.5 0.000000e+00 2167/2279 (95%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3583.6 0.000000e+00 2164/2275 (95%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3574.4 0.000000e+00 2167/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3568.8 0.000000e+00 2165/2280 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3555.9 0.000000e+00 2163/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3554.1 0.000000e+00 2160/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3552.2 0.000000e+00 2164/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3548.5 0.000000e+00 2155/2271 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3546.7 0.000000e+00 2163/2283 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3544.8 0.000000e+00 2141/2251 (95%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3541.1 0.000000e+00 2160/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3537.5 0.000000e+00 2160/2281 (94%)
EPI387907 A/wild bird/Korea/A323/2009 (A/H10N1) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469199 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 12:10 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3901.2 0.000000e+00 2138/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2131/2149 (99%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3784.9 0.000000e+00 2098/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3757.2 0.000000e+00 2090/2118 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3749.8 0.000000e+00 2084/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2080/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3552.2 0.000000e+00 2075/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3513.4 0.000000e+00 2069/2152 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2067/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3485.7 0.000000e+00 2065/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI337094 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI279945 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275981 A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI113102 A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275957 A/duck/Anhui/1/06 (A/H5N1) segment 3 (PA) 3432.2 0.000000e+00 2054/2152 (95%)
EPI337075 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI276045 A/goose/Hubei/65/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI175649 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 06, 2015 12:45 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1522.8 0.000000e+00 833/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 828/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 828/836 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 811/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 810/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 821/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 825/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1461.8 0.000000e+00 797/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 813/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1417.5 0.000000e+00 813/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1393.5 0.000000e+00 766/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1354.7 0.000000e+00 797/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI327035 A/duck/Korea/JS49/2004 (A/H3N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI296525 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI272784 A/mallard/PT/35910-2/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268623 A/mallard/Jiangxi/8341/2004 (A/H6N5) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Feb 07, 2015 9:50 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Isolate name:
A/crane/Kagoshima/KU1/2014
Isolate ID:
EPI_ISL_169390
Passage details/history:
E1
Type:
A / H5N8
Lineage:

Sample information
Collection date:
2014-11-23
Host
Other avian
Additional host information:
white-naped crane
Domestic status:
Wild
Is vaccinated:

Location:
Japan / Kagoshima
Additional location information:

Health status:
Sick
Specimen source:
Tracheal swab
Strain or commercial product name used for vaccination:

Institute information
Originating lab:
Kagoshima University

Sample ID given by the sample provider:

Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

Submitting lab:
Kagoshima University

Sample ID given by the submitting laboratory:

Authors:

Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

Publication
Publication
In vivo antiviral resistance
Phenotype
Genotype
Unspecified
Antiviral resistance tested by experimental procedures
Adamantanes:
Unknown
Oseltamivir:
Unknown
Zanamivir:
Unknown
Peramivir:
Unknown
Other:
Unknown










Additional information
Antigenic characterization:

Note:

Sequence
segment identifier length accession # INSDC Sequence

PB2
A/crane/Kagoshima/KU1/2014
2335
EPI553205


PB1
A/crane/Kagoshima/KU1/2014
2300
EPI553206


PA
A/crane/Kagoshima/KU1/2014
2197
EPI553207


HA
A/crane/Kagoshima/KU1/2014
1737
EPI553208


NP
A/crane/Kagoshima/KU1/2014
1553
EPI553209


NA
A/crane/Kagoshima/KU1/2014
1417
EPI553210


MP
A/crane/Kagoshima/KU1/2014
1009
EPI553211


NS
A/crane/Kagoshima/KU1/2014
887
EPI553212

Submitter information
Submitter:
Ozawa, Makoto
Submission Date:
2014-12-23
Last modifier:
Ozawa, Makoto
Last modified:
2014-12-23
Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Feb 07, 2015 9:53 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3090.6 0.000000e+00 1673/1673 (100%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3007.5 0.000000e+00 1658/1673 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3001.9 0.000000e+00 1657/1673 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1656/1674 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 2990.8 0.000000e+00 1655/1673 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 2985.3 0.000000e+00 1654/1673 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 2974.2 0.000000e+00 1653/1674 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 2968.7 0.000000e+00 1651/1673 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2963.1 0.000000e+00 1650/1673 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 2957.6 0.000000e+00 1649/1673 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 2957.6 0.000000e+00 1649/1673 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1647/1673 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2935.4 0.000000e+00 1645/1673 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2935.4 0.000000e+00 1645/1673 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2935.4 0.000000e+00 1645/1673 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2935.4 0.000000e+00 1645/1673 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2929.9 0.000000e+00 1644/1673 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2924.4 0.000000e+00 1643/1673 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2918.8 0.000000e+00 1643/1674 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2913.3 0.000000e+00 1633/1661 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2907.7 0.000000e+00 1633/1662 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2902.2 0.000000e+00 1634/1665 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2876.4 0.000000e+00 1605/1629 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2863.4 0.000000e+00 1615/1647 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2848.7 0.000000e+00 1584/1605 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1583/1606 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1585/1611 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1580/1605 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2769.2 0.000000e+00 1616/1673 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2763.7 0.000000e+00 1616/1674 (96%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1523/1545 (98%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2724.9 0.000000e+00 1610/1675 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2724.9 0.000000e+00 1609/1674 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2713.8 0.000000e+00 1607/1674 (95%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2708.3 0.000000e+00 1606/1674 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2697.2 0.000000e+00 1603/1673 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2697.2 0.000000e+00 1604/1674 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2691.7 0.000000e+00 1605/1676 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2691.7 0.000000e+00 1602/1673 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2686.1 0.000000e+00 1602/1674 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2686.1 0.000000e+00 1600/1672 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2675.1 0.000000e+00 1599/1673 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2669.5 0.000000e+00 1600/1675 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2669.5 0.000000e+00 1598/1673 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2658.4 0.000000e+00 1597/1674 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2658.4 0.000000e+00 1597/1674 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2658.4 0.000000e+00 1597/1674 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2658.4 0.000000e+00 1597/1674 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2658.4 0.000000e+00 1598/1675 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2652.9 0.000000e+00 1596/1674 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2647.4 0.000000e+00 1594/1673 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2647.4 0.000000e+00 1596/1675 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2636.3 0.000000e+00 1595/1676 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2603.0 0.000000e+00 1587/1674 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2575.3 0.000000e+00 1584/1676 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2575.3 0.000000e+00 1583/1675 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2569.8 0.000000e+00 1584/1677 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2569.8 0.000000e+00 1582/1675 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2560.6 0.000000e+00 1583/1678 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2560.6 0.000000e+00 1583/1678 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2514.4 0.000000e+00 1571/1674 (93%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2505.2 0.000000e+00 1572/1677 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2459.0 0.000000e+00 1562/1675 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2453.5 0.000000e+00 1561/1675 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2447.9 0.000000e+00 1559/1674 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2447.9 0.000000e+00 1560/1675 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2442.4 0.000000e+00 1560/1676 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2442.4 0.000000e+00 1560/1676 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2442.4 0.000000e+00 1559/1675 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2442.4 0.000000e+00 1559/1675 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 52 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group