Rhiza Labs FluTracker Forum
http://fluboard.rhizalabs.com/forum/

Fraser Valley Fujian H5N2 Index Matches Wild Crane In Japan
http://fluboard.rhizalabs.com/forum/viewtopic.php?f=5&t=13409
Page 1 of 1

Author:  niman [ Thu Jan 22, 2015 4:06 pm ]
Post subject:  Fraser Valley Fujian H5N2 Index Matches Wild Crane In Japan

CFIA has released a full set of Fujian H5N2 sequences, A/turkey/BC/FAV10/2014, from the Fraser Valley index farm (collected December 2, 2014). Five of the gene segments (PB2, PA, H5, MP, NS) match H5N8 sequences from a white-naped crane, A/crane/Kagoshima/KU1/2014, from Kagoshima, Japan.

Author:  niman [ Thu Jan 22, 2015 4:12 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

LOCUS KP307957 1704 bp cRNA linear VRL 21-JAN-2015
DEFINITION Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP307957
VERSION KP307957.1 GI:748113758
KEYWORDS .
SOURCE Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
ORGANISM Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T., Handel,K.
and Alexandersen,S.
TITLE Reassortant highly pathogenic Influenza A (H5N2) virus containing
Eurasian lineage H5 and four other gene segments from Eurasian H5N8
in Canada, 2014
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T.,
Suderman,M., Cottam-Birt,C., Handel,K. and Alexandersen,S.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-2014) Canadian Food Inspection Agency, National
Centre for Foreign Animal Disease, 1015 Arlington Street, Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers KP307954-KP307961 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNASTAR Lasergene v. 12
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/BC/FAV10/2014"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1589326"
/segment="4"
/country="Canada"
/collection_date="02-Dec-2014"
/note="passage details: 1CE-3dpi"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJE30360.1"
/db_xref="GI:748113759"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct ttttgcagtg attagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
241 ccaatgtgcg acgagttcat cagggtaccg gaatggtctt acatcgtgga gagggctaac
301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgttgg gacatcaaca
661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcagagtgga
721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatcaaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgacaaagt ccgactacag cttagggata atgcaaagga gctgggtaat
1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
1561 gtgaaattag aatcaatagg aacttaccag atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
1681 ttacaatgca gaatttgcat ctaa

Author:  niman [ Thu Jan 22, 2015 4:15 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

Isolate name:
A/crane/Kagoshima/KU1/2014
Isolate ID:
EPI_ISL_169390
Passage details/history:
E1
Type:
A / H5N8
Lineage:

Sample information
Collection date:
2014-11-23
Host
Other avian
Additional host information:
white-naped crane
Domestic status:
Wild
Is vaccinated:

Location:
Japan / Kagoshima
Additional location information:

Health status:
Sick
Specimen source:
Tracheal swab
Strain or commercial product name used for vaccination:

Institute information
Originating lab:
Kagoshima University

Sample ID given by the sample provider:

Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

Submitting lab:
Kagoshima University

Sample ID given by the submitting laboratory:

Authors:

Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

Publication
Publication
In vivo antiviral resistance
Phenotype
Genotype
Unspecified
Antiviral resistance tested by experimental procedures
Adamantanes:
Unknown
Oseltamivir:
Unknown
Zanamivir:
Unknown
Peramivir:
Unknown
Other:
Unknown










Additional information
Antigenic characterization:

Note:

Sequence
segment identifier length accession # INSDC Sequence

PB2
A/crane/Kagoshima/KU1/2014
2335
EPI553205


PB1
A/crane/Kagoshima/KU1/2014
2300
EPI553206


PA
A/crane/Kagoshima/KU1/2014
2197
EPI553207


HA
A/crane/Kagoshima/KU1/2014
1737
EPI553208


NP
A/crane/Kagoshima/KU1/2014
1553
EPI553209


NA
A/crane/Kagoshima/KU1/2014
1417
EPI553210


MP
A/crane/Kagoshima/KU1/2014
1009
EPI553211


NS
A/crane/Kagoshima/KU1/2014
887
EPI553212

Submitter information
Submitter:
Ozawa, Makoto
Submission Date:
2014-12-23
Last modifier:
Ozawa, Makoto
Last modified:
2014-12-23
Address:
Kagoshima University
1-21-24 Korimoto, Kagoshima Prefecture
Kagoshima 890-8580
Japan

Author:  niman [ Thu Jan 22, 2015 4:18 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1666/1693 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1656/1684 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1662/1693 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1628/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2911.4 0.000000e+00 1638/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2854.2 0.000000e+00 1588/1609 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1588/1612 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1587/1610 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1584/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1651/1708 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2826.5 0.000000e+00 1651/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1645/1710 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1644/1709 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1642/1709 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2760.0 0.000000e+00 1638/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1640/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1638/1709 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1524/1546 (98%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1633/1709 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2717.5 0.000000e+00 1631/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2699.1 0.000000e+00 1630/1711 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2665.8 0.000000e+00 1622/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2632.6 0.000000e+00 1618/1711 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1617/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2588.3 0.000000e+00 1608/1709 (94%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2568.0 0.000000e+00 1607/1712 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2516.3 0.000000e+00 1595/1709 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1593/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1594/1709 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2508.9 0.000000e+00 1594/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2505.2 0.000000e+00 1594/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1586/1700 (93%)
EPI337076 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI280104 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI275774 A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1592/1710 (93%)
EPI224777 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI181301 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI181298 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI164232 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI164224 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI107913 A/goose/Yunnan/1144/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI107829 A/goose/Guiyang/1304/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI107771 A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI406406 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI337107 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI280112 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI275966 A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI275386 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI170615 A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170607 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170599 A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170591 A/duck/Vietnam/219/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI108329 A/goose/Guangxi/1898/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1584/1700 (93%)
EPI270188 A/Vietnam/UT30850/2005 (A/H5N1) segment 4 (HA) 2486.7 0.000000e+00 1587/1705 (93%)
EPI106243 A/duck/Laos/3295/2006 (A/H5N1) segment 4 (HA) 2486.7 0.000000e+00 1591/1710 (93%)
EPI286383 A/chicken/Cao Bang/07-42/2007 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI286381 A/chicken/Nam Dinh/07-32/2007 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI275958 A/duck/Anhui/1/06 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1592/1712 (92%)
EPI275870 A/chicken/Sichuan/81/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI227371 A/muscovy duck/VietNam/209/2005 (A/H5) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI227010 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI181299 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI180956 A/duck/Laos/22/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI180951 A/duck/Laos/25/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI170742 A/duck/Vietnam/215/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI170741 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)

Author:  niman [ Thu Jan 22, 2015 4:20 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 977/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1722.2 0.000000e+00 948/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1683.4 0.000000e+00 913/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 959/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 909/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 953/979 (97%)
EPI337321 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI337314 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI280267 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI280259 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI275961 A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275873 A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275769 A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251431 A/Guangdong/1/2008 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251427 A/Anhui/1/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI235901 A/duck/Zhejiang/bj/2002 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI222571 A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI221720 A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164328 A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164304 A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164280 A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164267 A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI123805 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111884 A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111878 A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111641 A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111611 A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111608 A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111587 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI135982 A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 955/982 (97%)
EPI111659 A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 952/978 (97%)
EPI111527 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 952/978 (97%)
EPI530991 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI408138 A/chicken/Hmawbi/517/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406409 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406347 A/chicken/Hanoi/45/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406339 A/duck/Soc Trang/31/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI361519 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI350529 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)

Author:  niman [ Thu Jan 22, 2015 4:24 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4091.4 0.000000e+00 2255/2277 (99%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4082.2 0.000000e+00 2252/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2235/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2234/2256 (99%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 4002.8 0.000000e+00 2205/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3993.6 0.000000e+00 2204/2225 (99%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3984.3 0.000000e+00 2229/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2233/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3884.6 0.000000e+00 2222/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3801.5 0.000000e+00 2206/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3796.0 0.000000e+00 2092/2111 (99%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3707.3 0.000000e+00 2190/2281 (96%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3701.8 0.000000e+00 2188/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3663.0 0.000000e+00 2182/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3613.2 0.000000e+00 2174/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3613.2 0.000000e+00 2169/2275 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3592.9 0.000000e+00 2169/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3585.5 0.000000e+00 2167/2279 (95%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3583.6 0.000000e+00 2164/2275 (95%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3574.4 0.000000e+00 2167/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3568.8 0.000000e+00 2165/2280 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3555.9 0.000000e+00 2163/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3554.1 0.000000e+00 2160/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3552.2 0.000000e+00 2164/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3548.5 0.000000e+00 2155/2271 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3546.7 0.000000e+00 2163/2283 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3544.8 0.000000e+00 2141/2251 (95%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3541.1 0.000000e+00 2160/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3537.5 0.000000e+00 2160/2281 (94%)
EPI387907 A/wild bird/Korea/A323/2009 (A/H10N1) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469199 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469198 A/duck/Jiangxi/3169/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469197 A/duck/Jiangxi/3141/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469196 A/duck/Jiangxi/3096/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469142 A/duck/Jiangxi/3257/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469141 A/duck/Jiangxi/3152/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469135 A/duck/Jiangxi/3283/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI341923 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI272276 A/chicken/Korea/A170/2009 (A/H9N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI229247 A/duck/Beijing/40/04 (A/H3N8) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI269178 A/duck/Hunan/491/2005 (A/H6N2) segment 1 (PB2) 3524.5 0.000000e+00 2159/2283 (94%)
EPI231158 A/spot-billed duck/Korea/534/2008 (A/H6N1) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI231134 A/mallard/Korea/L08-8/2008 (A/H6N1) segment 1 (PB2) 3524.5 0.000000e+00 2157/2280 (94%)
EPI231166 A/spot-billed duck/Korea/536/2008 (A/H6N1) segment 1 (PB2) 3520.8 0.000000e+00 2142/2259 (94%)
EPI363928 A/duck/Guizhou/1560/2007 (A/H6N8) segment 1 (PB2) 3519.0 0.000000e+00 2158/2283 (94%)
EPI345513 A/duck/Eastern China/50/2002 (A/H6N8) segment 1 (PB2) 3519.0 0.000000e+00 2158/2283 (94%)
EPI341932 A/duck/Nanjing/20/2010 (A/H1N3) segment 1 (PB2) 3519.0 0.000000e+00 2156/2281 (94%)
EPI341883 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI306420 A/mallard/Korea/KNU YP09/2009 (A/H1N1) segment 1 (PB2) 3519.0 0.000000e+00 2152/2275 (94%)
EPI284618 A/duck/Hunan/8-19/2009 (A/H4N2) segment 1 (PB2) 3519.0 0.000000e+00 2156/2281 (94%)
EPI118429 A/migratory duck/Hong Kong/MP206/2004 (A/H5N2) segment 1 (PB2) 3517.1 0.000000e+00 2125/2234 (95%)
EPI469148 A/duck/Jiangxi/3292/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2148/2270 (94%)
EPI401301 A/wild duck/Korea/CSM20-5/2009 (A/H4N6) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI341939 A/duck/Nanjing/19/2010 (A/H1N3) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI341891 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI272275 A/chicken/Korea/A146/2009 (A/H9N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI222161 A/mallard/Altai/1208/2007 (A/H3N6) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI222076 A/gadwall/Altai/1328/2007 (A/H3N8) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI219337 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 1 (PB2) 3513.4 0.000000e+00 2158/2284 (94%)
EPI469230 A/duck/Jiangxi/22041/2008 (A/H4N9) segment 1 (PB2) 3507.9 0.000000e+00 2156/2283 (94%)
EPI461800 A/environment/Hunan/S4304/2011 (A/H3N2) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432530 r8 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432522 r78 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432514 r7 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)

Author:  niman [ Thu Jan 22, 2015 4:25 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2131/2149 (99%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3784.9 0.000000e+00 2098/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3757.2 0.000000e+00 2090/2118 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3749.8 0.000000e+00 2084/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2080/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3552.2 0.000000e+00 2075/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3513.4 0.000000e+00 2069/2152 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2067/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3485.7 0.000000e+00 2065/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI337094 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI279945 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275981 A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI113102 A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275957 A/duck/Anhui/1/06 (A/H5N1) segment 3 (PA) 3432.2 0.000000e+00 2054/2152 (95%)
EPI337075 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI276045 A/goose/Hubei/65/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI175649 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170596 A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI164237 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI139938 A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113254 A/duck/Guiyang/1558/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113160 A/duck/Fujian/720/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113158 A/duck/Fujian/671/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113122 A/duck/Hunan/5472/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113024 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI530984 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI509692 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI337082 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI275869 A/chicken/Sichuan/81/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI275377 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI270187 A/Vietnam/UT30850/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2050/2148 (95%)
EPI170719 A/chicken/Vietnam/202/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170679 A/duck/Vietnam/207/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170663 A/chicken/Vietnam/209/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170641 A/chicken/Vietnam/212/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI164229 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113244 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113156 A/duck/Fujian/668/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113098 A/duck/Guiyang/293/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113092 A/chicken/Guiyang/3721/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113074 A/duck/Guangxi/5457/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI337113 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI337106 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI280116 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI280108 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI275773 A/chicken/Hunan/21/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI227015 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI170671 A/duck/Vietnam/208/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI170627 A/duck/Vietnam/215/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI113246 A/goose/Guiyang/4030/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)

Author:  niman [ Thu Jan 22, 2015 4:28 pm ]
Post subject:  Re: Fraser Valley Fujian H5N2 Index Matches Wild Crane In Ja

EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 828/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 828/836 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 811/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 810/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 821/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 825/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1461.8 0.000000e+00 797/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 813/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1417.5 0.000000e+00 813/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1393.5 0.000000e+00 766/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1354.7 0.000000e+00 797/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI327035 A/duck/Korea/JS49/2004 (A/H3N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI296525 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI272784 A/mallard/PT/35910-2/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268623 A/mallard/Jiangxi/8341/2004 (A/H6N5) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI251804 A/mallard/Sweden/8/2003 (A/H8N4) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI251738 A/mallard/Sweden/50/2002 (A/H3N8) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI238134 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI224485 A/mallard/Netherlands/2/2005 (A/H5N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI174829 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI102384 A/duck/Taiwan/WB459/04 (A/H6N5) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI21460 A/mallard/Italy/43/2001 (A/H7N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI21458 A/mallard/Italy/33/01 (A/H7N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI514930 A/mallard/Sweden/337/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514923 A/mallard/Sweden/310/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514878 A/mallard/Sweden/1195/2002 (A/H4N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514871 A/mallard/Sweden/1194/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514857 A/mallard/Sweden/814/2002 (A/H4N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI485744 A/mallard/Sweden/49/2002 (A/H5N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI485572 A/mallard/Sweden/9/2003 (A/H2N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI470704 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI470665 A/eurasian wigeon/Hong Kong/MPK653/2009 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI470656 A/eurasian wigeon/Hong Kong/MPK655/2009 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI451131 A/mallard/Netherlands/10-Nmkt/1999 (A/H0) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI447410 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI447397 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI377922 A/mallard/Sweden/103/2005 (A/H2N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI377840 A/mallard/Sweden/9/2003 (A/H2N7) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377770 A/mallard/Sweden/30/2002 (A/H2N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377660 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377572 A/mallard/Sweden/88/2005 (A/H0) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI363531 A/duck/Guizhou/1426/2006 (A/H6N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI363523 A/duck/Guizhou/1084/2006 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI327037 A/environment/Korea/CSM08/2004 (A/H3N3) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI296532 A/mallard/Netherlands/4/2006 (A/H10N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268622 A/mallard/Jiangxi/8346/2004 (A/H6N5) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268526 A/mallard/Jiangxi/8264/2004 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268502 A/duck/Hunan/491/2005 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI268483 A/mallard/Jiangxi/227/2003 (A/H6N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI251773 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)

Page 1 of 1 All times are UTC - 5 hours [ DST ]
Powered by phpBB® Forum Software © phpBB Group
http://www.phpbb.com/