Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Sep 19, 2017 4:43 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 22 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Thu Jan 22, 2015 10:48 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Canadian Food Inspection Agency has released a full set of H5N2 sequences from the index turkey, A/turkey/BC/FAV10/2014, collected December 2, 2014..

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 10:57 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP307957 1704 bp cRNA linear VRL 21-JAN-2015
DEFINITION Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP307957
VERSION KP307957.1 GI:748113758
KEYWORDS .
SOURCE Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
ORGANISM Influenza A virus (A/turkey/BC/FAV10/2014(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T., Handel,K.
and Alexandersen,S.
TITLE Reassortant highly pathogenic Influenza A (H5N2) virus containing
Eurasian lineage H5 and four other gene segments from Eurasian H5N8
in Canada, 2014
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1704)
AUTHORS Pasick,J., Berhane,Y., Joseph,T., Bowes,V., Hisanaga,T.,
Suderman,M., Cottam-Birt,C., Handel,K. and Alexandersen,S.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-2014) Canadian Food Inspection Agency, National
Centre for Foreign Animal Disease, 1015 Arlington Street, Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers KP307954-KP307961 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNASTAR Lasergene v. 12
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus
(A/turkey/BC/FAV10/2014(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/BC/FAV10/2014"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1589326"
/segment="4"
/country="Canada"
/collection_date="02-Dec-2014"
/note="passage details: 1CE-3dpi"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJE30360.1"
/db_xref="GI:748113759"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct ttttgcagtg attagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
241 ccaatgtgcg acgagttcat cagggtaccg gaatggtctt acatcgtgga gagggctaac
301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgttgg gacatcaaca
661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcagagtgga
721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatcaaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgacaaagt ccgactacag cttagggata atgcaaagga gctgggtaat
1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
1561 gtgaaattag aatcaatagg aacttaccag atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
1681 ttacaatgca gaatttgcat ctaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:03 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1666/1693 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1656/1684 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2952.1 0.000000e+00 1662/1693 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1628/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2911.4 0.000000e+00 1638/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2854.2 0.000000e+00 1588/1609 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1588/1612 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1587/1610 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1584/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1651/1708 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2826.5 0.000000e+00 1651/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1645/1710 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1644/1709 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1642/1709 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2760.0 0.000000e+00 1638/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1640/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1638/1709 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1524/1546 (98%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1633/1709 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2717.5 0.000000e+00 1631/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2699.1 0.000000e+00 1630/1711 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2665.8 0.000000e+00 1622/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2638.1 0.000000e+00 1618/1710 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2632.6 0.000000e+00 1618/1711 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1617/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2623.4 0.000000e+00 1618/1713 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2588.3 0.000000e+00 1608/1709 (94%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2568.0 0.000000e+00 1607/1712 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2516.3 0.000000e+00 1595/1709 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1593/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1594/1709 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2508.9 0.000000e+00 1594/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2505.2 0.000000e+00 1594/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1586/1700 (93%)
EPI337076 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI280104 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI275774 A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1592/1710 (93%)
EPI224777 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI181301 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI181298 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI164232 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI164224 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)
EPI107913 A/goose/Yunnan/1144/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI107829 A/goose/Guiyang/1304/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI107771 A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1585/1700 (93%)
EPI406406 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI337107 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI280112 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI275966 A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI275386 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1591/1710 (93%)
EPI170615 A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170607 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170599 A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI170591 A/duck/Vietnam/219/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1590/1709 (93%)
EPI108329 A/goose/Guangxi/1898/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1584/1700 (93%)
EPI270188 A/Vietnam/UT30850/2005 (A/H5N1) segment 4 (HA) 2486.7 0.000000e+00 1587/1705 (93%)
EPI106243 A/duck/Laos/3295/2006 (A/H5N1) segment 4 (HA) 2486.7 0.000000e+00 1591/1710 (93%)
EPI286383 A/chicken/Cao Bang/07-42/2007 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI286381 A/chicken/Nam Dinh/07-32/2007 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI275958 A/duck/Anhui/1/06 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1592/1712 (92%)
EPI275870 A/chicken/Sichuan/81/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI227371 A/muscovy duck/VietNam/209/2005 (A/H5) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI227010 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI181299 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI180956 A/duck/Laos/22/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI180951 A/duck/Laos/25/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1590/1710 (92%)
EPI170742 A/duck/Vietnam/215/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI170741 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI418959 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 6 (NA) 2494.1 0.000000e+00 1390/1410 (98%)
EPI512135 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI450007 A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI418807 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI418497 A/blue-winged teal/Illinois/10OS3610/2010 (A/H6N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI418609 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI332004 A/blue-winged teal/Guatemala/CIP049-10/2009 (A/H11N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI331988 A/blue-winged teal/Guatemala/CIP049-03/2009 (A/H11N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI512150 A/northern shoveler/Mississippi/12OS456/2012 (A/H14N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI420145 A/northern shoveler/California/3676/2010 (A/H8N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI419288 A/American wigeon/Iowa/10OS2748/2010 (A/H2N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI418472 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI387177 A/mallard/California/2396/2010 (A/H5N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI333605 A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI331996 A/blue-winged teal/Guatemala/CIP049-11/2009 (A/H11N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512531 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512524 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI418721 A/mallard/Wisconsin/10OS2538/2010 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI512591 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI419654 A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419111 A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419077 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419138 A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI419118 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI221406 A/American green-winged teal/California/HKWF609/2007 (A/H5N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI419647 A/mallard/Missouri/10MO0253/2010 (A/H1N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI413459 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI328608 A/northern shoveler/California/8855/2008 (A/H5N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI280744 A/avian/Missouri/466554-6/2006 (A/H5N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI513011 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 6 (NA) 2422.1 0.000000e+00 1378/1411 (97%)
EPI328639 A/mallard/California/11100/2008 (A/H11N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI328582 A/northern shoveler/California/9680/2008 (A/H6N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI328476 A/green-winged teal/California/11285/2008 (A/H0) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI328156 A/mallard/California/11353/2008 (A/H10N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI328489 A/green-winged teal/California/7972/2008 (A/H6N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI328108 A/northern shoveler/California/9017/2008 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI419755 A/northern shoveler/California/2815/2011 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI327900 A/northern pintail/California/6791/2008 (A/H11N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI285601 A/wild bird/Wisconsin/433163-1/2006 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI420032 A/mallard/California/2571V/2011 (A/H0) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI420024 A/mallard/California/2571P/2011 (A/H11N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI418643 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI334262 A/mallard/Iowa/3195/2009 (A/H0) segment 6 (NA) 2405.5 0.000000e+00 1375/1411 (97%)
EPI442430 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI285602 A/wild bird/Wisconsin/439436-2/2006 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI285592 A/wild bird/Wisconsin/439436/2006 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI328316 A/mallard/California/6420/2008 (A/H6N2) segment 6 (NA) 2388.8 0.000000e+00 1372/1411 (97%)
EPI299469 A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI299389 A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI299381 A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI280848 A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI449517 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413390 A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413383 A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413369 A/mallard/Ohio/10OS1467/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285597 A/mallard/NV/450206/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285595 A/mallard/NV/449567-4/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285594 A/mallard/NV/449567-2/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI280656 A/mallard/Arkansas/473507-9/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI280544 A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI222394 A/northern pintail/Saskatchewan/22910/2007 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI187901 A/mallard/Minnesota/Sg-00129/2007 (A/H6N2) segment 6 (NA) 2379.6 0.000000e+00 1362/1399 (97%)
EPI449695 A/green-winged teal/Minnesota/Sg-01073/2008 (A/H6N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI449653 A/mallard/Minnesota/Sg-01040/2008 (A/H3N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI285593 A/mallard/NV/449567-1/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI280552 A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI76383 A/mallard/Maryland/182/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI512972 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512920 A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512832 A/mallard/Wisconsin/11OS3491/2011 (A/H4N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512507 A/mallard/Wisconsin/11OS3171/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI419063 A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI334137 A/blue-winged teal/Wisconsin/3060/2009 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI299648 A/American green-winged teal/Illinois/08OS2311/2008 (A/H0) segment 6 (NA) 2372.2 0.000000e+00 1369/1411 (97%)
EPI299477 A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 6 (NA) 2372.2 0.000000e+00 1369/1411 (97%)
EPI285598 A/mallard/NV/453350-8/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI513071 A/American green-winged teal/Wisconsin/11OS3580/2011 (A/H12N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI513025 A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI512986 A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI455888 A/mallard/New Jersey/Sg-00884/2008 (A/H11N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI419090 A/mallard/Wisconsin/10OS3067/2010 (A/H4N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI413404 A/mallard/Michigan/10OS1497/2010 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI285578 A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI220636 A/mallard/South Dakota/Sg-00457/2008 (A/H4N2) segment 6 (NA) 2364.8 0.000000e+00 1360/1400 (97%)
EPI513141 A/American green-winged teal/Wisconsin/11OS3069/2011 (A/H0) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513105 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513085 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI512955 A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI419070 A/mallard/Wisconsin/10OS3051/2010 (A/H4N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI418714 A/mallard/Wisconsin/10OS2524/2010 (A/H11N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513133 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512993 A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512941 A/mallard/Illinois/11OS4311/2011 (A/H4N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI455945 A/mallard/New Jersey/Sg-00942/2008 (A/H0) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI448307 A/mallard/Minnesota/346250/2000 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1365/1411 (96%)
EPI327355 A/American black duck/Newfoundland and Labrador/26516/2007 (A/H3N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI292632 A/mallard/Washington/44338-120/2007 (A/H6N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI159142 A/mallard/MN/113/2000 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1365/1411 (96%)
EPI513093 A/long-tailed duck/Wisconsin/11OS4599/2011 (A/H4N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI234273 A/blue-winged teal/Minnesota/Sg-00797/2008 (A/H3N2) segment 6 (NA) 2344.5 0.000000e+00 1349/1389 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:08 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1801.6 0.000000e+00 977/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 977/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1722.2 0.000000e+00 948/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1683.4 0.000000e+00 913/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1676.0 0.000000e+00 959/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 909/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 957/983 (97%)
EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 953/979 (97%)
EPI337321 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI337314 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI280267 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI280259 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI275961 A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275873 A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275769 A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251431 A/Guangdong/1/2008 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251427 A/Anhui/1/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI235901 A/duck/Zhejiang/bj/2002 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI222571 A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI221720 A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164328 A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164304 A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164280 A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI164267 A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI123805 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111884 A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111878 A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111641 A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111611 A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111608 A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI111587 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI135982 A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 955/982 (97%)
EPI111659 A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 952/978 (97%)
EPI111527 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP) 1663.1 0.000000e+00 952/978 (97%)
EPI530991 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI408138 A/chicken/Hmawbi/517/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406409 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406347 A/chicken/Hanoi/45/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI406339 A/duck/Soc Trang/31/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI361519 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI350529 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:11 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4091.4 0.000000e+00 2255/2277 (99%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4082.2 0.000000e+00 2252/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2235/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2234/2256 (99%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 4002.8 0.000000e+00 2205/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3993.6 0.000000e+00 2204/2225 (99%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3984.3 0.000000e+00 2229/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2233/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3884.6 0.000000e+00 2222/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3801.5 0.000000e+00 2206/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3796.0 0.000000e+00 2092/2111 (99%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3707.3 0.000000e+00 2190/2281 (96%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3701.8 0.000000e+00 2188/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3663.0 0.000000e+00 2182/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3613.2 0.000000e+00 2174/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3613.2 0.000000e+00 2169/2275 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3592.9 0.000000e+00 2169/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3585.5 0.000000e+00 2167/2279 (95%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3583.6 0.000000e+00 2164/2275 (95%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3574.4 0.000000e+00 2167/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3568.8 0.000000e+00 2165/2280 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3555.9 0.000000e+00 2163/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3554.1 0.000000e+00 2160/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3552.2 0.000000e+00 2164/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3548.5 0.000000e+00 2155/2271 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3546.7 0.000000e+00 2163/2283 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3544.8 0.000000e+00 2141/2251 (95%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3541.1 0.000000e+00 2160/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3537.5 0.000000e+00 2160/2281 (94%)
EPI387907 A/wild bird/Korea/A323/2009 (A/H10N1) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469199 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469198 A/duck/Jiangxi/3169/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469197 A/duck/Jiangxi/3141/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469196 A/duck/Jiangxi/3096/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469142 A/duck/Jiangxi/3257/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469141 A/duck/Jiangxi/3152/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469135 A/duck/Jiangxi/3283/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI341923 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI272276 A/chicken/Korea/A170/2009 (A/H9N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI229247 A/duck/Beijing/40/04 (A/H3N8) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI269178 A/duck/Hunan/491/2005 (A/H6N2) segment 1 (PB2) 3524.5 0.000000e+00 2159/2283 (94%)
EPI231158 A/spot-billed duck/Korea/534/2008 (A/H6N1) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI231134 A/mallard/Korea/L08-8/2008 (A/H6N1) segment 1 (PB2) 3524.5 0.000000e+00 2157/2280 (94%)
EPI231166 A/spot-billed duck/Korea/536/2008 (A/H6N1) segment 1 (PB2) 3520.8 0.000000e+00 2142/2259 (94%)
EPI363928 A/duck/Guizhou/1560/2007 (A/H6N8) segment 1 (PB2) 3519.0 0.000000e+00 2158/2283 (94%)
EPI345513 A/duck/Eastern China/50/2002 (A/H6N8) segment 1 (PB2) 3519.0 0.000000e+00 2158/2283 (94%)
EPI341932 A/duck/Nanjing/20/2010 (A/H1N3) segment 1 (PB2) 3519.0 0.000000e+00 2156/2281 (94%)
EPI341883 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI306420 A/mallard/Korea/KNU YP09/2009 (A/H1N1) segment 1 (PB2) 3519.0 0.000000e+00 2152/2275 (94%)
EPI284618 A/duck/Hunan/8-19/2009 (A/H4N2) segment 1 (PB2) 3519.0 0.000000e+00 2156/2281 (94%)
EPI118429 A/migratory duck/Hong Kong/MP206/2004 (A/H5N2) segment 1 (PB2) 3517.1 0.000000e+00 2125/2234 (95%)
EPI469148 A/duck/Jiangxi/3292/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2148/2270 (94%)
EPI401301 A/wild duck/Korea/CSM20-5/2009 (A/H4N6) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI341939 A/duck/Nanjing/19/2010 (A/H1N3) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI341891 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI272275 A/chicken/Korea/A146/2009 (A/H9N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI222161 A/mallard/Altai/1208/2007 (A/H3N6) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI222076 A/gadwall/Altai/1328/2007 (A/H3N8) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI219337 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 1 (PB2) 3513.4 0.000000e+00 2158/2284 (94%)
EPI469230 A/duck/Jiangxi/22041/2008 (A/H4N9) segment 1 (PB2) 3507.9 0.000000e+00 2156/2283 (94%)
EPI461800 A/environment/Hunan/S4304/2011 (A/H3N2) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432530 r8 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432522 r78 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI432514 r7 (A/H5N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI420193 A/bufflehead/California/3118/2011 (A/H4N8) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI418616 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI512660 A/wood duck/Wisconsin/11OS3443/2011 (A/H11N9) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI512230 A/mallard/Arkansas/12OS179/2012 (A/H1N1) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI436582 A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI418963 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI453910 A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI436612 A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI436589 A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI387181 A/mallard/California/2396/2010 (A/H5N2) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI512474 A/blue-winged teal/Missouri/11OS2563/2011 (A/H12N4) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI452523 A/northern pintail/Interior Alaska/10BM12413R0/2010 (A/H8N4) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI451651 A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI436619 A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI433197 A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI420073 A/mallard/California/2578V/2011 (A/H0) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419953 A/mallard/California/2559P/2011 (A/H5N8) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419909 A/mallard/California/2552V/2011 (A/H4N8) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419869 A/mallard/California/2542V/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419842 A/mallard/California/2536P/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419835 A/mallard/California/2535V/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419828 A/mallard/California/2535P/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI398563 A/chicken/Jalisco/12283/2012 (A/H7N3) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI513088 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI512676 A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420142 A/mallard/California/2595V/2011 (A/H12N5) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420135 A/mallard/California/2595P/2011 (A/H12N5) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420114 A/mallard/California/2590V/2011 (A/H4N6) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420087 A/mallard/California/2584V/2011 (A/H4N9) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420080 A/mallard/California/2584P/2011 (A/H4N9) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419939 A/mallard/California/2555V/2011 (A/H11N9) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419916 A/mallard/California/2555P/2011 (A/H11N9) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419807 A/mallard/California/2531V/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419794 A/mallard/California/2531P/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419786 A/mallard/California/2527V/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI387271 A/northern shoveler/California/3628/2011 (A/H10) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI527489 A/blue-winged teal/TX/AI13-1028/2013 (A/H14N5) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI420128 A/mallard/California/2594V/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI420121 A/mallard/California/2594P/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI420101 A/mallard/California/2589V/2011 (A/H4N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI420094 A/mallard/California/2589P/2011 (A/H4N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419855 A/mallard/California/2536V/2011 (A/H5N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419821 A/mallard/California/2533V/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419779 A/mallard/California/2525P/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI418440 A/mallard/California/2525V/2011 (A/H0) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI531395 A/blue-winged teal/Guatemala/CIP049H105-15/2011 (A/H14N3) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI531387 A/blue-winged teal/Guatemala/CIP049H106-62/2011 (A/H14N6) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI513151 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512252 A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI449635 A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI420214 A/green-winged teal/California/123/2012 (A/H1N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419981 A/mallard/California/2566P/2011 (A/H4N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419974 A/mallard/California/2563V/2011 (A/H4N6) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419967 A/mallard/California/2563P/2011 (A/H4N6) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512871 A/northern pintail/Wisconsin/11OS3299/2011 (A/H4N6) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI512587 A/American green-winged teal/Mississippi/11OS5869/2011 (A/H4N6) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI512355 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI512726 A/American green-winged teal/Wisconsin/11OS3425/2011 (A/H12N5) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI512185 A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI512139 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI333682 A/mallard/Ohio/1695/2009 (A/H4N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419590 A/blue-winged teal/Missouri/10MO0011/2010 (A/H3N6) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI393386 A/Mexico/InDRE7218/2012 (A/H7N3) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI299489 A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI449684 A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI448650 A/blue-winged teal/North Dakota/Sg-00706/2008 (A/H4N6) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI448643 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI188754 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI227361 A/mallard/Quebec/16566/2005 (A/H11N2) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI512401 A/blue-winged teal/Missouri/11OS2585/2011 (A/H4N8) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI419081 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI418706 A/American green-winged teal/Illinois/10OS1598/2010 (A/H4N8) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI333882 A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI69001 A/environment/Maryland/763/2006 (A/H11N9) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI542115 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI512534 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI512527 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI512297 A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 2 (PB1) 3962.2 0.000000e+00 2232/2275 (98%)
EPI512244 A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 2 (PB1) 3962.2 0.000000e+00 2232/2275 (98%)
EPI435694 A/mallard/Alberta/65/2004 (A/H10N7) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI438118 A/mallard/Alberta/56/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI435708 A/mallard/Alberta/67/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI435687 A/mallard/Alberta/62/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI188436 A/mallard/Minnesota/Sg-00579/2008 (A/H1N1) segment 2 (PB1) 3956.6 0.000000e+00 2231/2275 (98%)
EPI438125 A/mallard/Alberta/57/2004 (A/H10N7) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI435717 A/mallard/Alberta/68/2004 (A/H10N7) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI435701 A/mallard/Alberta/66/2004 (A/H10N7) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI225176 A/mallard/Quebec/10969/2006 (A/H2N3) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI225280 A/mallard/Quebec/11247/2006 (A/H3N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI225272 A/mallard/Quebec/11194/2006 (A/H3N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI526170 A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI418856 A/mallard/Wisconsin/10OS4194/2010 (A/H11N9) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI512779 A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI333730 A/northern shovelerMissouri/196/2009 (A/H10N3) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI280628 A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI418932 A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI449877 A/blue-winged Teal/Texas/AI09-3464/2009 (A/H4N8) segment 2 (PB1) 3912.3 0.000000e+00 2223/2275 (97%)
EPI328240 A/mallard/California/8212/2008 (A/H6N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI334115 A/mallard/Illinois/3747/2009 (A/H6N1) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)
EPI297962 A/blue-winged teal/Texas/Sg-00082/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:14 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2131/2149 (99%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3784.9 0.000000e+00 2098/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3757.2 0.000000e+00 2090/2118 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3749.8 0.000000e+00 2084/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2080/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3552.2 0.000000e+00 2075/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3513.4 0.000000e+00 2069/2152 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2067/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3485.7 0.000000e+00 2065/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI337094 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI279945 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275981 A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI113102 A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275957 A/duck/Anhui/1/06 (A/H5N1) segment 3 (PA) 3432.2 0.000000e+00 2054/2152 (95%)
EPI337075 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI276045 A/goose/Hubei/65/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI175649 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170596 A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI164237 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI139938 A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113254 A/duck/Guiyang/1558/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113160 A/duck/Fujian/720/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113158 A/duck/Fujian/671/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113122 A/duck/Hunan/5472/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113024 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI530984 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI509692 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI337082 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI275869 A/chicken/Sichuan/81/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI275377 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI270187 A/Vietnam/UT30850/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2050/2148 (95%)
EPI170719 A/chicken/Vietnam/202/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170679 A/duck/Vietnam/207/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170663 A/chicken/Vietnam/209/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI170641 A/chicken/Vietnam/212/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI164229 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113244 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113156 A/duck/Fujian/668/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113098 A/duck/Guiyang/293/2006 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113092 A/chicken/Guiyang/3721/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2053/2152 (95%)
EPI113074 A/duck/Guangxi/5457/2005 (A/H5N1) segment 3 (PA) 3424.8 0.000000e+00 2052/2151 (95%)
EPI337113 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI337106 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI280116 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI280108 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI275773 A/chicken/Hunan/21/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI227015 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI170671 A/duck/Vietnam/208/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI170627 A/duck/Vietnam/215/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2051/2151 (95%)
EPI113246 A/goose/Guiyang/4030/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:16 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI526421 A/American green-winged teal/Ohio/13OS2086/2013 (A/H6N8) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI526348 A/American green-winged teal/Ohio/13OS2084/2013 (A/H6N8) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI513134 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI512973 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI512391 A/northern pintail/Illinois/11OS4796/2011 (A/H5N3) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI512368 A/northern shoveler/Illinois/11OS4707/2011 (A/H4N6) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI513005 A/northern shoveler/Wisconsin/11OS4110/2011 (A/H4N6) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI512353 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI526332 A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512695 A/mallard/Wisconsin/11OS4309/2011 (A/H4N6) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512616 A/mallard/Wisconsin/11OS4310/2011 (A/H4N6) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI418744 A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI418737 A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512928 A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512749 A/northern shoveler/Wisconsin/11OS3013/2011 (A/H4N8) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI449581 A/green-winged teal/Minnesota/Sg-01000/2008 (A/H3N6) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI449553 A/mallard/Minnesota/Sg-00930/2008 (A/H11N9) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI419628 A/mallard/Missouri/10MO084/2010 (A/H5N9) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI475450 A/northern shoveler/Minnesota/Sg-00655/2008 (A/H1N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI468600 A/northern shoveler/Minnesota/Sg-00651/2008 (A/H1N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI450064 A/red-necked grebe/Minnesota/AI10-2528/2010 (A/H4N8) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI449397 A/northern shoveler/Minnesota/Sg-00665/2008 (A/H0) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI448589 A/mallard/Minnesota/Sg-00620/2008 (A/H1N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI419491 A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI418903 A/blue-winged teal/Wisconsin/10OS2862/2010 (A/H3N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI334171 A/mallard/Illinois/3974/2009 (A/H5N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI468579 A/mallard/Minnesota/Sg-00627/2008 (A/H1N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI468414 A/mallard/Minnesota/Sg-00628/2008 (A/H1N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI433780 A/blue-winged teal/Nova Scotia/00067/2010 (A/H0) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI419506 A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI334289 A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI328603 A/northern shoveler/California/9079/2008 (A/H4N4) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI328067 A/northern shoveler/California/10024/2008 (A/H4N4) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI449387 A/mallard/Minnesota/Sg-0617/2008 (A/H1N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI419169 A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI486895 A/mallard/California/3471/2012 (A/H4N6) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI328083 A/northern shoveler/California/9267/2008 (A/H4N6) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI328091 A/northern shoveler/California/9228/2008 (A/H4N6) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI526489 A/blue-winged teal/Iowa/13OS2338/2013 (A/H4N6) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI513149 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI387206 A/mallard/California/3134/2010 (A/H1N1) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI342993 A/mallard/Alberta/507/2008 (A/H3N8) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI327399 A/ring-necked duck/Ontario/15530/2005 (A/H3N2) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI542020 A/Northern shoveler/Alaska/ND0006934/2013 (A/H10N7) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI60013 A/american black duck/Ohio/1823/2005 (A/H11N9) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI419789 A/northern shoveler/California/2815/2011 (A/H5N2) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI327691 A/mallard/California/5386/2009 (A/H5N2) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI289855 A/mallard/Alaska/44430-088/2008 (A/H1N1) segment 5 (NP) 2593.8 0.000000e+00 1458/1485 (98%)
EPI420190 A/bufflehead/California/3118/2011 (A/H4N8) segment 5 (NP) 2588.3 0.000000e+00 1466/1498 (97%)
EPI418611 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI328395 A/mallard/California/5219/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327827 A/mallard/California/5212/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327819 A/mallard/California/5222/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327811 A/mallard/California/5250/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327795 A/mallard/California/5276/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327779 A/mallard/California/5296/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327763 A/mallard/California/5502/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327747 A/mallard/California/5174/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327715 A/mallard/California/5319/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327699 A/mallard/California/5359/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI327683 A/mallard/California/5491/2009 (A/H5N2) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI420033 A/mallard/California/2571V/2011 (A/H0) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI420025 A/mallard/California/2571P/2011 (A/H11N2) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI387353 A/mallard/California/5197/2009 (A/H5N2) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI327675 A/mallard/California/5191/2009 (A/H5N2) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI343406 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI343398 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327755 A/mallard/California/5149/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI296781 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI296773 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI542118 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI343306 A/mallard/Alberta/297/2006 (A/H4N6) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI486683 A/mallard/California/3070/2012 (A/H11N2) segment 5 (NP) 2555.0 0.000000e+00 1460/1498 (97%)
EPI456387 A/ruddy turnstone/New Jersey/AI09-1211/2009 (A/H1N9) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI456359 A/ruddy turnstone/New Jersey/AI09-1082/2009 (A/H1N9) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI450089 A/red-necked grebe/Minnesota/AI10-2531/2010 (A/H0) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI178791 A/northern shoveler/California/HKWF2031/2008 (A/H7N3) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI456486 A/ruddy turnstone/New Jersey/AI09-1381/2009 (A/H1N9) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI436056 A/shorebird/Delaware Bay/351/2009 (A/H1N9) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI456189 A/ruddy turnstone/New Jersey/AI09-618/2009 (A/H1N9) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI433751 A/ring-billed gull/Quebec/G192/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433744 A/ring-billed gull/Quebec/G139/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433737 A/ring-billed gull/Quebec/G068/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433730 A/ring-billed gull/Quebec/G066/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433696 A/ring-billed gull/Quebec/G018/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI454918 A/ruddy turnstone/New Jersey/1321394/2005 (A/H3N6) segment 5 (NP) 2477.5 0.000000e+00 1445/1497 (96%)
EPI227473 A/ruddy turnstone/New Jersey/327/2005 (A/H3N6) segment 5 (NP) 2477.5 0.000000e+00 1445/1497 (96%)
EPI59975 A/environment/Delaware/251/2005 (A/H3N6) segment 5 (NP) 2477.5 0.000000e+00 1445/1497 (96%)
EPI343659 A/shorebird/Delaware Bay/117/2005 (A/H0) segment 5 (NP) 2471.9 0.000000e+00 1444/1497 (96%)
EPI343651 A/shorebird/Delaware Bay/140/2005 (A/H3N6) segment 5 (NP) 2471.9 0.000000e+00 1444/1497 (96%)
EPI343627 A/shorebird/Delaware Bay/161/2005 (A/H3N6) segment 5 (NP) 2471.9 0.000000e+00 1444/1497 (96%)
EPI59823 A/environment/Delaware/245/2005 (A/H3N6) segment 5 (NP) 2471.9 0.000000e+00 1444/1497 (96%)
EPI343643 A/shorebird/Delaware Bay/148/2005 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI343635 A/shorebird/Delaware Bay/153/2005 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI88487 A/mallard/ALB/196/1996 (A/H10N7) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI22413 A/pintail/Alberta/156/97 (A/H3N8) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI173542 A/mallard/Ohio/363/2003 (A/H2N1) segment 5 (NP) 2449.8 0.000000e+00 1440/1497 (96%)
EPI236166 A/mallard/Ohio/686/2002 (A/H4N2) segment 5 (NP) 2444.2 0.000000e+00 1439/1497 (96%)
EPI85368 A/mallard/ALB/201/1996 (A/H2N3) segment 5 (NP) 2444.2 0.000000e+00 1439/1497 (96%)
EPI238529 A/mallard/Minnesota/204/1999 (A/H6N8) segment 5 (NP) 2438.7 0.000000e+00 1438/1497 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 11:19 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 828/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 828/836 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 811/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1482.1 0.000000e+00 810/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 821/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 825/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1461.8 0.000000e+00 797/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 813/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1417.5 0.000000e+00 813/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1393.5 0.000000e+00 766/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1354.7 0.000000e+00 797/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI327035 A/duck/Korea/JS49/2004 (A/H3N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI296525 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI272784 A/mallard/PT/35910-2/2006 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268623 A/mallard/Jiangxi/8341/2004 (A/H6N5) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI251804 A/mallard/Sweden/8/2003 (A/H8N4) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI251738 A/mallard/Sweden/50/2002 (A/H3N8) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI238134 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI224485 A/mallard/Netherlands/2/2005 (A/H5N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI174829 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI102384 A/duck/Taiwan/WB459/04 (A/H6N5) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI21460 A/mallard/Italy/43/2001 (A/H7N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI21458 A/mallard/Italy/33/01 (A/H7N3) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI514930 A/mallard/Sweden/337/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514923 A/mallard/Sweden/310/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514878 A/mallard/Sweden/1195/2002 (A/H4N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514871 A/mallard/Sweden/1194/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514857 A/mallard/Sweden/814/2002 (A/H4N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI485744 A/mallard/Sweden/49/2002 (A/H5N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI485572 A/mallard/Sweden/9/2003 (A/H2N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI470704 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI470665 A/eurasian wigeon/Hong Kong/MPK653/2009 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI470656 A/eurasian wigeon/Hong Kong/MPK655/2009 (A/H11N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI451131 A/mallard/Netherlands/10-Nmkt/1999 (A/H0) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI447410 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI447397 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI377922 A/mallard/Sweden/103/2005 (A/H2N9) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI377840 A/mallard/Sweden/9/2003 (A/H2N7) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377770 A/mallard/Sweden/30/2002 (A/H2N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377660 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI377572 A/mallard/Sweden/88/2005 (A/H0) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI363531 A/duck/Guizhou/1426/2006 (A/H6N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI363523 A/duck/Guizhou/1084/2006 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI327037 A/environment/Korea/CSM08/2004 (A/H3N3) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI296532 A/mallard/Netherlands/4/2006 (A/H10N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268622 A/mallard/Jiangxi/8346/2004 (A/H6N5) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268526 A/mallard/Jiangxi/8264/2004 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI268502 A/duck/Hunan/491/2005 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI268483 A/mallard/Jiangxi/227/2003 (A/H6N1) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI251773 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 22 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 70 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group