Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 10:22 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2
Author Message
PostPosted: Thu Jan 22, 2015 7:18 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KC282882 1027 bp cRNA linear VRL 19-APR-2013
DEFINITION Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2)) segment 7 matrix
protein 2 (M2) and matrix protein 1 (M1) genes, complete cds.
ACCESSION KC282882
VERSION KC282882.1 GI:440133803
KEYWORDS .
SOURCE Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2))
ORGANISM Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1027)
AUTHORS Zhao,Q., Li,Q., Zhong,L., Gu,M., Zhu,J., Zhao,G., Chen,C., Wang,X.,
Liu,X. and Liu,X.
TITLE Complete Genomic Sequence of a Novel Reassortant H4N2 Avian
Influenza Virus Isolated from Domestic Ducks in Jiangsu, China
JOURNAL Genome Announc 1 (2), E0009113 (2013)
PUBMED 23516214
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1027)
AUTHORS Zhao,Q.Q., Li,Q.H., Gu,M., Zhong,L. and Liu,X.F.
TITLE Direct Submission
JOURNAL Submitted (04-DEC-2012) Animal Infectious Disease Laboratory,
School of Veterinary Medicine, Yangzhou University, 48 East Wenhui
Road, Yangzhou, Jiangsu 225009, China
COMMENT GenBank Accession Numbers KC282876-KC282883 represent sequences
from the 8 segments of influenza A virus
(A/duck/Jiangsu/1-15/2011(H4N2)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1027
/organism="Influenza A virus
(A/duck/Jiangsu/1-15/2011(H4N2))"
/mol_type="viral cRNA"
/strain="A/duck/Jiangsu/1-15/2011"
/serotype="H4N2"
/host="duck"
/db_xref="taxon:1266774"
/segment="7"
/country="China"
/collection_date="12-Jan-2011"
gene 26..1007
/gene="M2"
CDS join(26..51,740..1007)
/gene="M2"
/codon_start=1
/product="matrix protein 2"
/protein_id="AGB84775.1"
/db_xref="GI:440133805"
/translation="MSLLTEVETPTRTEWECRCSDSSDPLVVAANIIGILHLILWILD
RLFFKCIYRRLKYGLRIGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE"
gene 26..784
/gene="M1"
CDS 26..784
/gene="M1"
/codon_start=1
/product="matrix protein 1"
/protein_id="AGB84774.1"
/db_xref="GI:440133804"
/translation="MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALME
WLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKK
LKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHR
SHRQMATITNPLIRHENRMVLASTTAKAMEQMAGSSEQASEAMEVANQARQMVQAMRT
IGTHPNSSAGLRDNLLENLQAYQNRMGVQMQRFK"
ORIGIN
1 agcgaaagca ggtagatgtt gaaagatgag tcttctaacc gaggtcgaaa cgtacgttct
61 ctctatcatc ccgtcaggcc ccctcaaagc cgagatcgcg cagagacttg aagatgtctt
121 tgcagggaaa aacaccgatc tcgaggctct catggagtgg ctaaagacaa gaccaatcct
181 gtcacctctg actaaaggga ttttgggatt tgtgttcacg ctcaccgtgc ccagtgagcg
241 aggactgcag cgtagacgct ttgtccagaa tgccctaaat ggaaatggag atccaaataa
301 tatggatagg gcagttaagc tatataagaa gctgaaaaga gagataacat tccatggggc
361 taaggaggtc gcacttagct actcaaccgg tgcacttgcc agctgcatgg gtctcatata
421 caacaggatg ggaacggtga ctacggaagt ggcttttggc ctagtgtgtg ccacttgtga
481 gcagattgca gattcacagc atcggtccca cagacagatg gcaaccatca ccaacccatt
541 aatcagacat gagaacagaa tggtgctggc cagcactaca gctaaggcca tggagcagat
601 ggcgggatca agcgagcagg catcagaagc catggaggtt gctaatcagg ctaggcagat
661 ggtacaggca atgaggacaa ttgggactca tcctaactct agtgctggtc tgagagataa
721 tcttcttgaa aatttgcagg cctaccagaa ccgaatggga gtgcagatgc agcgattcaa
781 gtgatcctct tgttgttgcc gcaaatatca ttgggatctt gcacttgata ttgtggatcc
841 ttgatcgtct tttcttcaaa tgcatttatc gtcgcctcaa atacggtttg agaatagggc
901 cttctacgga aggggtacct gagtctatga gggaagagta ccggcaggaa cagcagagtg
961 ctgtggatgt tgacgatggt cattttgtca acatagaatt ggagtaaaaa actaccttgt
1021 ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:22 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1770.2 0.000000e+00 972/979 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 971/979 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1751.7 0.000000e+00 968/978 (98%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1751.7 0.000000e+00 968/978 (98%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1751.7 0.000000e+00 968/978 (98%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1720.4 0.000000e+00 966/983 (98%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 964/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 962/983 (97%)
EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 958/979 (97%)
EPI337321 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI280267 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI275961 A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI275769 A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI251431 A/Guangdong/1/2008 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI251427 A/Anhui/1/2007 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI222571 A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI221720 A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI164328 A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI164304 A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI164280 A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI164267 A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI123805 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI111884 A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI111878 A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI111641 A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI111611 A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI111608 A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI111587 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 961/983 (97%)
EPI135982 A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP) 1690.8 0.000000e+00 960/982 (97%)
EPI111659 A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP) 1690.8 0.000000e+00 957/978 (97%)
EPI111527 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP) 1690.8 0.000000e+00 957/978 (97%)
EPI361519 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI350529 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI280091 A/Hunan/1/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI276009 A/duck/Hunan/69/2004 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI275873 A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI275777 A/chicken/Hunan/21/2005 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI275465 A/Guangxi/1/2005 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI251424 A/Guangdong/2/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI227011 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI225090 A/duck/Nam Dinh/218/2006 (A/H5) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI180954 A/duck/Laos/25/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI174623 A/duck/Hunan/3315/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI174615 A/chicken/Hunan/1793/2007 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI174613 A/duck/Henan/1650/2006 (A/H5N1) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 24, 2015 9:50 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
New H5N2, H5N8 viruses not transmissible to humans: CDC
Central News Agency
2015-01-24 04:46 PM
Fonts Size A+
Printer-Friendly Printer

Taipei, Jan. 24 (CNA) The new H5N2 and H5N8 avian influenza virus strains recently detected on poultry farms in Taiwan are not transmissible to humans, Taiwan's Centers for Disease Control (CDC) said Saturday. An analysis of the genome sequence of the viruses indicates that they are of avian origin and entered Taiwan recently, according to CDC deputy chief Chuang Jen-hsiang (???). The H5N2 and H5N8 strains did not mutate from viruses found previously in Taiwan, he said. The H5N8 virus isolated in Taiwan is highly homologous with the strains found in South Korea, Japan, the United States, Canada and Germany and it shows weak ability to replicate in mammals, Chuang said. Compared with the H7N9 virus that can infect humans, the H5N8 virus is significantly less risky, he said. He stressed the new H5N2 and H5N8 outbreaks in Taiwan are limited to poultry and that there have been no reports of human infection. The CDC will continue to monitor the outbreaks and check for any mutations of the viruses, he added. (By Lung Pei-ning and Y.F. Low)

http://www.taiwannews.com.tw/etn/news_c ... DTN+Taiwan:

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 49 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group