Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 6:48 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 10 posts ] 
Author Message
PostPosted: Sat Jan 17, 2015 8:42 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Wuhan Institute of Virology has released a full set of H5N6 sequences (at Genbank) from water in Sichuan which matches the first fatal case, 49M in April, 2014 in Sichuan.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 8:42 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM251468 1704 bp cRNA linear VRL 15-JAN-2015
DEFINITION Influenza A virus (A/environment/Sichuan/NCLL1/2014(H5N6)) segment
4 hemagglutinin (HA) gene, complete cds.
ACCESSION KM251468
VERSION KM251468.1 GI:673249439
KEYWORDS .
SOURCE Influenza A virus (A/environment/Sichuan/NCLL1/2014(H5N6))
ORGANISM Influenza A virus (A/environment/Sichuan/NCLL1/2014(H5N6))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Bi,Y., Chen,Q. and Chen,J.
TITLE Novel reassortant avian influenza A(H5N6) viruses, China, 2014
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1704)
AUTHORS Bi,Y., Chen,Q. and Chen,J.
TITLE Direct Submission
JOURNAL Submitted (31-JUL-2014) Wuhan Institute of Virology, CAS,
Xiaohongshan 44#, Wuhan, Hubei 430071, P.R. China
COMMENT GenBank Accession Numbers KM251468, KM251478, KM251491, KM251498,
KM251508, KM251518, KM251528, KM251538 represent sequences from the
8 segments of Influenza A virus
(A/environment/Sichuan/NCLL1/2014(H5N6)).

##Assembly-Data-START##
Assembly Method :: DNAMAN v. 7
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus
(A/environment/Sichuan/NCLL1/2014(H5N6))"
/mol_type="viral cRNA"
/strain="A/environment/Sichuan/NCLL1/2014"
/serotype="H5N6"
/isolation_source="water"
/db_xref="taxon:1529600"
/segment="4"
/country="China"
/collection_date="06-May-2014"
/note="passage details: egg"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIK26441.1"
/db_xref="GI:673249440"
/translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGNLNDYEELKHLLSRINHFEKILIIPKSSWTNHETSLGVSAACPYQGTPSFF
RNVVWLIKKNDAYPTIKISYNNTNQEDLLILWGVHHSNNAAEQTNLYKNPTTYISVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLREKRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct tcttgcaata gtcagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcgacggag caggttgaca cgataatgga aaagaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca atggaaagct ctgcgattta
181 aatggagtga agcctctgat tttaaaggat tgtagtgtag ctggatggct tctcggaaac
241 ccaatgtgcg acgaattcat cagggtgccg gaatggtctt acatagtaga aagggctaac
301 ccagccaatg acctctgtta cccagggaac ctcaatgatt atgaagaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaatt ctgatcatcc ccaagagttc ttggaccaat
421 catgaaacat cattaggggt gagcgcagca tgcccatacc agggaacgcc ctcctttttc
481 agaaatgtgg tatggcttat caaaaagaac gatgcatacc ccacaataaa aataagctac
541 aataatacca atcaggaaga tctgttaata ctgtgggggg ttcaccattc caacaatgca
601 gcagagcaga cgaacctcta taaaaaccca accacctata tttccgttgg gacatcaaca
661 ttaaaccaga gattggtacc aaaaatagct actagatccc aagtgaacgg acagcgtgga
721 agaatggatt tcttctggac aattctaaaa ccgaatgatg caatccactt cgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aagtggaata tggccactgc aacaccaaat gtcaaactcc aataggggcg
901 ataaactcta gtatgccatt tcacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaaat caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 aagagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag atggctggta tgggtaccac catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatccaccca aaaggctata gatggagtta ccaataaggt caactcgatt
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttc tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgataaagt ccgactacag cttagggaca atgcaaagga actgggtaat
1441 ggttgttttg agttctatca caaatgtgat aatgaatgta tggaaagtgt aagaaatggg
1501 acatatgact acccgcaata ttcagaagaa gcaagattaa aaagagaaga aataagcgga
1561 gtgaaattag agtcaatagg aacttaccaa atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc caatgggtcg
1681 ttacaatgca gaatttgcat ttaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 8:49 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2959.5 0.000000e+00 1670/1704 (98%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2944.7 0.000000e+00 1668/1705 (97%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1656/1704 (97%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2865.3 0.000000e+00 1653/1704 (97%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2854.2 0.000000e+00 1651/1704 (96%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1649/1704 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2843.1 0.000000e+00 1650/1705 (96%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1648/1704 (96%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2837.6 0.000000e+00 1648/1704 (96%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1647/1704 (96%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2832.0 0.000000e+00 1647/1704 (96%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1646/1705 (96%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2815.4 0.000000e+00 1645/1705 (96%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2793.3 0.000000e+00 1641/1705 (96%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2761.9 0.000000e+00 1638/1708 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2760.0 0.000000e+00 1636/1706 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2760.0 0.000000e+00 1636/1706 (95%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2748.9 0.000000e+00 1633/1705 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1633/1706 (95%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2743.4 0.000000e+00 1632/1705 (95%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2734.2 0.000000e+00 1633/1708 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1631/1708 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1631/1708 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1631/1708 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1631/1708 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1630/1708 (95%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 2704.6 0.000000e+00 1628/1708 (95%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 2704.6 0.000000e+00 1628/1708 (95%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2688.0 0.000000e+00 1623/1706 (95%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2678.8 0.000000e+00 1624/1709 (95%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2660.3 0.000000e+00 1621/1709 (94%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1619/1708 (94%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2643.7 0.000000e+00 1618/1709 (94%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2643.7 0.000000e+00 1618/1709 (94%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2638.1 0.000000e+00 1617/1709 (94%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2638.1 0.000000e+00 1615/1707 (94%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2638.1 0.000000e+00 1615/1707 (94%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2638.1 0.000000e+00 1615/1707 (94%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2632.6 0.000000e+00 1615/1708 (94%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1614/1707 (94%)
EPI224777 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1614/1707 (94%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2632.6 0.000000e+00 1614/1707 (94%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2627.1 0.000000e+00 1607/1697 (94%)
EPI337107 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2627.1 0.000000e+00 1613/1707 (94%)
EPI280112 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2627.1 0.000000e+00 1613/1707 (94%)
EPI280104 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2627.1 0.000000e+00 1613/1707 (94%)
EPI181301 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2627.1 0.000000e+00 1613/1707 (94%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 2625.2 0.000000e+00 1613/1706 (94%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1612/1707 (94%)
EPI275870 A/chicken/Sichuan/81/2005 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1612/1707 (94%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1606/1698 (94%)
EPI106026 A/China/GD01/2006 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1612/1707 (94%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2619.7 0.000000e+00 1609/1703 (94%)
EPI276070 A/shrike/Tibet/13/2006 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1612/1708 (94%)
EPI275966 A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI275386 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1612/1708 (94%)
EPI227293 A/Mallard/Huadong/S/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI170615 A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI170607 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI170599 A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI170591 A/duck/Vietnam/219/2005 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1611/1707 (94%)
EPI107771 A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA) 2616.0 0.000000e+00 1605/1698 (94%)
EPI337121 A/Sichuan/3/2006 (A/H5N1) segment 4 (HA) 2614.1 0.000000e+00 1610/1707 (94%)
EPI280018 A/Sichuan/3/2006 (A/H5N1) segment 4 (HA) 2614.1 0.000000e+00 1610/1707 (94%)
EPI337141 A/Anhui/1/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI337076 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI280032 A/Anhui/1/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI275958 A/duck/Anhui/1/06 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1611/1708 (94%)
EPI275774 A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI270188 A/Vietnam/UT30850/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1608/1704 (94%)
EPI227371 A/muscovy duck/VietNam/209/2005 (A/H5) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI227010 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI181299 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1611/1708 (94%)
EPI181298 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170742 A/duck/Vietnam/215/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170741 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170740 A/chicken/Vietnam/212/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170739 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170738 A/duck/Vietnam/210/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170714 A/chicken/Vietnam/202/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170690 A/duck/Vietnam/205/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170674 A/duck/Vietnam/207/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI170658 A/chicken/Vietnam/209/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI164250 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1611/1708 (94%)
EPI164232 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI164224 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1610/1707 (94%)
EPI164216 A/Anhui/1/2005 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1611/1708 (94%)
EPI108329 A/goose/Guangxi/1898/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1604/1698 (94%)
EPI106243 A/duck/Laos/3295/2006 (A/H5N1) segment 4 (HA) 2610.4 0.000000e+00 1609/1705 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 8:53 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533584 A/Sichuan/26221/2014 (A/H5N6) segment 6 (NA) 2599.4 0.000000e+00 1411/1413 (99%)
EPI547404 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 6 (NA) 2544.0 0.000000e+00 1401/1413 (99%)
EPI500989 A/Duck/Guangdong/S3073/2010 (A/H6N6) segment 6 (NA) 2416.5 0.000000e+00 1378/1413 (97%)
EPI501133 A/Duck/Zhejiang/S4204/2010 (A/H6N6) segment 6 (NA) 2383.3 0.000000e+00 1372/1413 (97%)
EPI501101 A/Duck/Hunan/S4273/2010 (A/H6N6) segment 6 (NA) 2377.8 0.000000e+00 1371/1413 (97%)
EPI500869 A/Chicken/Guangdong/S1414/2010 (A/H6N6) segment 6 (NA) 2372.2 0.000000e+00 1370/1413 (96%)
EPI500853 A/Chicken/Guangdong/S1311/2010 (A/H6N6) segment 6 (NA) 2372.2 0.000000e+00 1370/1413 (96%)
EPI501013 A/Duck/Guangdong/S3468/2010 (A/H6N6) segment 6 (NA) 2366.7 0.000000e+00 1369/1413 (96%)
EPI500981 A/Duck/Guangdong/S1155/2011 (A/H6N6) segment 6 (NA) 2361.1 0.000000e+00 1369/1414 (96%)
EPI501005 A/Duck/Guangdong/S3225/2010 (A/H6N6) segment 6 (NA) 2350.1 0.000000e+00 1366/1413 (96%)
EPI501125 A/Duck/Zhejiang/S1134/2011 (A/H6N6) segment 6 (NA) 2344.5 0.000000e+00 1365/1413 (96%)
EPI501021 A/Duck/Guangdong/S4018/2010 (A/H6N6) segment 6 (NA) 2339.0 0.000000e+00 1364/1413 (96%)
EPI364508 A/duck/Fujian/3242/2007 (A/H6N6) segment 6 (NA) 2322.4 0.000000e+00 1361/1413 (96%)
EPI364932 A/duck/Fujian/3076/2007 (A/H6N6) segment 6 (NA) 2311.3 0.000000e+00 1359/1413 (96%)
EPI501149 A/Goose/Guangdong/S4362/2009 (A/H6N6) segment 6 (NA) 2305.7 0.000000e+00 1358/1413 (96%)
EPI364506 A/duck/Fujian/3002/2007 (A/H6N6) segment 6 (NA) 2300.2 0.000000e+00 1357/1413 (96%)
EPI501117 A/Duck/Zhejiang/S1023/2010 (A/H6N6) segment 6 (NA) 2292.8 0.000000e+00 1355/1412 (95%)
EPI364888 A/duck/Fujian/2984/2007 (A/H6N6) segment 6 (NA) 2278.0 0.000000e+00 1353/1413 (95%)
EPI500997 A/Duck/Guangdong/S3180/2010 (A/H6N6) segment 6 (NA) 2276.2 0.000000e+00 1353/1413 (95%)
EPI501045 A/Duck/Guangxi/S4111/2010 (A/H6N6) segment 6 (NA) 2272.5 0.000000e+00 1352/1413 (95%)
EPI364510 A/duck/Fujian/3460/2007 (A/H6N6) segment 6 (NA) 2272.5 0.000000e+00 1353/1414 (95%)
EPI365155 A/duck/Fujian/2749/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI365131 A/duck/Fujian/2278/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI365107 A/duck/Fujian/912/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI365103 A/duck/Fujian/816/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI364925 A/duck/Fujian/3059/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1351/1413 (95%)
EPI364504 A/duck/Fujian/2969/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI364494 A/duck/Fujian/1772/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI364480 A/duck/Fujian/576/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI364474 A/duck/Fujian/118/2007 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI364470 A/duck/Fujian/10706/2006 (A/H6N6) segment 6 (NA) 2267.0 0.000000e+00 1352/1414 (95%)
EPI500901 A/Chicken/Guangxi/S4381/2010 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1350/1413 (95%)
EPI471883 A/duck/Guangxi/GXd-7/2011 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1350/1413 (95%)
EPI365139 A/duck/Fujian/2356/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI365115 A/duck/Fujian/1879/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI365080 A/duck/Fujian/8807/2006 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364512 A/duck/Fujian/3756/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364500 A/duck/Fujian/2724/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364490 A/duck/Fujian/1322/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364458 A/duck/Fujian/7652/2006 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364117 A/duck/Fujian/3264/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI364060 A/duck/Fujian/378/2007 (A/H6N6) segment 6 (NA) 2261.4 0.000000e+00 1351/1414 (95%)
EPI365162 A/duck/Fujian/10950/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI365109 A/duck/Fujian/1107/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI365095 A/duck/Fujian/402/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1351/1415 (95%)
EPI365088 A/duck/Fujian/145/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1351/1415 (95%)
EPI364502 A/duck/Fujian/2818/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI364497 A/duck/Fujian/2582/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1351/1415 (95%)
EPI364464 A/duck/Fujian/8388/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI364462 A/duck/Fujian/8114/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI364454 A/duck/Fujian/6908/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI364450 A/duck/Fujian/6222/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1351/1415 (95%)
EPI364109 A/duck/Fujian/2321/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI363877 A/duck/Fujian/11418/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI363829 A/duck/Fujian/5498/2006 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1351/1415 (95%)
EPI363739 A/duck/Fujian/2787/2007 (A/H6N6) segment 6 (NA) 2255.9 0.000000e+00 1350/1414 (95%)
EPI364092 A/duck/Fujian/2018/2007 (A/H6N6) segment 6 (NA) 2254.0 0.000000e+00 1349/1413 (95%)
EPI365058 A/duck/Fujian/2606/2006 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1350/1415 (95%)
EPI364896 A/duck/Fujian/4224/2007 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1349/1414 (95%)
EPI364532 A/duck/Fujian/6908/2007 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1350/1415 (95%)
EPI364446 A/duck/Fujian/3574/2006 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1350/1415 (95%)
EPI364067 A/duck/Fujian/603/2007 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1350/1415 (95%)
EPI363853 A/duck/Fujian/9062/2006 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1349/1414 (95%)
EPI363837 A/duck/Fujian/6708/2006 (A/H6N6) segment 6 (NA) 2250.3 0.000000e+00 1350/1415 (95%)
EPI364102 A/duck/Fujian/2060/2007 (A/H6N6) segment 6 (NA) 2248.5 0.000000e+00 1348/1413 (95%)
EPI515017 A/duck/Hunan/749/2011 (A/H0) segment 6 (NA) 2244.8 0.000000e+00 1347/1413 (95%)
EPI515007 A/duck/Hunan/747/2011 (A/H0) segment 6 (NA) 2244.8 0.000000e+00 1347/1413 (95%)
EPI461657 A/duck/Hunan/S1661/2012 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1347/1413 (95%)
EPI365147 A/duck/Fujian/2483/2007 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1349/1415 (95%)
EPI365123 A/duck/Fujian/2087/2007 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1349/1415 (95%)
EPI365050 A/duck/Fujian/2281/2006 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1349/1415 (95%)
EPI364520 A/duck/Fujian/4719/2007 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1349/1415 (95%)
EPI364468 A/duck/Fujian/9308/2006 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1348/1414 (95%)
EPI364452 A/duck/Fujian/6634/2006 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1348/1414 (95%)
EPI364076 A/duck/Fujian/1565/2007 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1349/1415 (95%)
EPI363861 A/duck/Fujian/10774/2006 (A/H6N6) segment 6 (NA) 2244.8 0.000000e+00 1348/1414 (95%)
EPI438437 A/duck/Vietnam/LBM6/2011 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1346/1413 (95%)
EPI365099 A/duck/Fujian/679/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI365066 A/duck/Fujian/6605/2006 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364997 A/duck/Fujian/7375/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364952 A/duck/Fujian/5239/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364948 A/duck/Fujian/4952/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1347/1414 (95%)
EPI364518 A/duck/Fujian/4509/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1347/1414 (95%)
EPI364444 A/duck/Fujian/3046/2006 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364337 A/duck/Fujian/1904/2006 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364187 A/duck/Fujian/7818/2007 (A/H6N6) segment 6 (NA) 2239.3 0.000000e+00 1348/1415 (95%)
EPI364084 A/duck/Fujian/1804/2007 (A/H6N6) segment 6 (NA) 2237.4 0.000000e+00 1346/1413 (95%)
EPI365092 A/duck/Fujian/331/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI365042 A/duck/Fujian/1674/2006 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI365007 A/duck/Fujian/7608/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI364968 A/duck/Fujian/5784/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1348/1416 (95%)
EPI364528 A/duck/Fujian/6182/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI364522 A/duck/Fujian/5198/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI364341 A/duck/Fujian/2595/2006 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI364201 A/duck/Fujian/7130/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI364133 A/duck/Fujian/4652/2007 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI363781 A/duck/Fujian/1651/2006 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI268290 A/duck/Fujian/12035/2005 (A/H6N6) segment 6 (NA) 2233.7 0.000000e+00 1347/1415 (95%)
EPI382203 A/duck/Vietnam/OIE-1213/2012 (A/H6N6) segment 6 (NA) 2231.9 0.000000e+00 1342/1409 (95%)
EPI441024 A/duck/Vietnam/LBM235/2012 (A/H3N6) segment 6 (NA) 2228.2 0.000000e+00 1344/1413 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 8:55 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533589 A/Sichuan/26221/2014 (A/H5N6) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI547405 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI438172 A/Shenzhen/1/2011 (A/H5N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI461758 A/duck/Hunan/S4220/2011 (A/H5N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI425283 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI425275 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI405131 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI461491 A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI460935 A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI438232 A/oriental magpie robin/Hong Kong/470.1/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI337023 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI337021 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI337020 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI337019 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI337018 A/duck/Zhejiang/224/2011 (A/H5N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI438234 A/large billed crow/Hong Kong/497/2011 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI438233 A/brown-headed gull/Hong Kong/709/2011 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI425902 A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI425595 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI425195 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI424389 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI375434 A/Hong Kong/5923/2012 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI337017 A/duck/Zhejiang/213/2011 (A/H5N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI516034 A/chicken/Yinmarbin/A295/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI475610 A/wild duck/Fujian/2/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI475606 A/wild duck/Fujian/1/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI461539 A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI461025 A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI438245 A/chicken/Viet Nam/3/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI427338 A/chicken/Vietnam/NCVD-686/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425942 A/chicken/Vietnam/NCVD-715/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI425926 A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425918 A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425870 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425862 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425854 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425683 A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425675 A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425635 A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425339 A/chicken/Vietnam/NCVD-753/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425227 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425179 A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425171 A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425147 A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425139 A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425107 A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI425027 A/duck/Vietnam/NCVD-754/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424987 A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424979 A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424939 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424931 A/chicken/Vietnam/NCVD-752/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424923 A/duck/Vietnam/NCVD-947/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI424875 A/duck/Vietnam/NCVD-1029/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI424843 A/duck/Vietnam/NCVD-1018/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI424835 A/duck/Vietnam/NCVD-952/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI424731 A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI424691 A/duck/Vietnam/NCVD-948/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 972/983 (98%)
EPI424381 A/chicken/Vietnam/NCVD-685/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI387938 A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI351364 A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI350153 A/chicken/Vietnam/NCVD-390/2009 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI350146 A/chicken/Vietnam/NCVD-389/2009 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI348918 A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI348855 A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI545542 A/duck/Khanhhoa/CVVI-23/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545541 A/duck/Khanhhoa/CVVI-22/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545536 A/duck/Khanhhoa/CVVI-17/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545532 A/chicken/Khanhhoa/CVVI-13/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545527 A/duck/Khanhhoa/CVVI-08/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545525 A/duck/Khanhhoa/CVVI-06/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545524 A/duck/Khanhhoa/CVVI-05/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545523 A/duck/Khanhhoa/CVVI-04/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545522 A/duck/Khanhhoa/CVVI-03/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545521 A/chicken/Khanhhoa/CVVI-02/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI545520 A/duck/Khanhhoa/CVVI-01/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI471176 A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI471134 A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI461691 A/duck/Hunan/S4030/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI459260 A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI459250 A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI459242 A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI438170 A/swine/Guangxi/ns592/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI427345 A/chicken/Vietnam/NCVD-700/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI427331 A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425950 A/chicken/Vietnam/NCVD-1038/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 971/983 (98%)
EPI425806 A/duck/Vietnam/NCVD-1048/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 971/983 (98%)
EPI425798 A/duck/Vietnam/NCVD-1044/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 971/983 (98%)
EPI425790 A/duck/Vietnam/NCVD-1042/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 971/983 (98%)
EPI425782 A/chicken/Vietnam/NCVD-1040/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 971/983 (98%)
EPI425651 A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425643 A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425627 A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425619 A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425555 A/duck/Vietnam/NCVD-645/2010 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425531 A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425523 A/chicken/Vietnam/NCVD-802/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425315 A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425307 A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425267 A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI425243 A/chicken/Vietnam/NCVD-1177/2012 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 8:57 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533585 A/Sichuan/26221/2014 (A/H5N6) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI424669 A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 1 (PB2) 4045.3 0.000000e+00 2251/2281 (98%)
EPI461753 A/duck/Hunan/S4220/2011 (A/H5N1) segment 1 (PB2) 4017.6 0.000000e+00 2246/2281 (98%)
EPI347459 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 1 (PB2) 4002.8 0.000000e+00 2228/2258 (98%)
EPI459254 A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 1 (PB2) 3989.9 0.000000e+00 2241/2281 (98%)
EPI461485 A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2240/2281 (98%)
EPI460929 A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2240/2281 (98%)
EPI531453 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 1 (PB2) 3962.2 0.000000e+00 2236/2281 (98%)
EPI530059 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 1 (PB2) 3956.6 0.000000e+00 2235/2281 (97%)
EPI550750 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 1 (PB2) 3951.1 0.000000e+00 2234/2281 (97%)
EPI475607 A/wild duck/Fujian/2/2011 (A/H5N1) segment 1 (PB2) 3951.1 0.000000e+00 2235/2282 (97%)
EPI550761 A/duck/Laos/XBY004/2014 (A/H5N6) segment 1 (PB2) 3945.6 0.000000e+00 2233/2281 (97%)
EPI530051 A/duck/Jiangxi/95/2014 (A/H5N6) segment 1 (PB2) 3945.6 0.000000e+00 2233/2281 (97%)
EPI475600 A/wild duck/Fujian/1/2011 (A/H5N1) segment 1 (PB2) 3945.6 0.000000e+00 2233/2281 (97%)
EPI492509 A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425872 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425864 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425856 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425285 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425277 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI425229 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI405133 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI387918 A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI424941 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 1 (PB2) 3934.5 0.000000e+00 2231/2281 (97%)
EPI425597 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI425197 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI424391 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI425904 A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 1 (PB2) 3923.4 0.000000e+00 2229/2281 (97%)
EPI424885 A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 1 (PB2) 3917.9 0.000000e+00 2228/2281 (97%)
EPI425485 A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI425005 A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI424893 A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI424869 A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI424861 A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI375501 A/Hong Kong/5923/2012 (A/H5N1) segment 1 (PB2) 3901.2 0.000000e+00 2226/2282 (97%)
EPI336981 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 1 (PB2) 3890.2 0.000000e+00 2217/2272 (97%)
EPI336979 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 1 (PB2) 3890.2 0.000000e+00 2217/2272 (97%)
EPI336978 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 1 (PB2) 3890.2 0.000000e+00 2217/2272 (97%)
EPI336977 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 1 (PB2) 3890.2 0.000000e+00 2217/2272 (97%)
EPI336976 A/duck/Zhejiang/224/2011 (A/H5N1) segment 1 (PB2) 3890.2 0.000000e+00 2217/2272 (97%)
EPI350489 A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 1 (PB2) 3851.4 0.000000e+00 2215/2280 (97%)
EPI401607 A/duck/Guangxi/GXd-5/2010 (A/H6N1) segment 1 (PB2) 3845.8 0.000000e+00 2215/2281 (97%)
EPI539357 A/Viet Nam/CM32/2011 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2214/2281 (97%)
EPI424957 A/duck/Vietnam/NCVD-891/2010 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2214/2281 (97%)
EPI351366 A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2213/2280 (97%)
EPI427326 A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI425944 A/chicken/Vietnam/NCVD-715/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI425525 A/chicken/Vietnam/NCVD-802/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI425445 A/duck/Vietnam/NCVD-1219/2012 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI424949 A/duck/Vietnam/NCVD-890/2010 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI424909 A/duck/Vietnam/NCVD-943/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI424821 A/duck/Vietnam/NCVD-806/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI424367 A/duck/Vietnam/NCVD-664/2010 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI424359 A/duck/Vietnam/NCVD-1206/2012 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI387917 A/muscovy duck/Vietnam/LBM57/2011 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI337228 A/Hubei/1/2010 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI267029 A/Hubei/1/2010 (A/H5N1) segment 1 (PB2) 3834.8 0.000000e+00 2213/2281 (97%)
EPI425912 A/duck/Vietnam/NCVD-1304/2012 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI425557 A/duck/Vietnam/NCVD-645/2010 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI425429 A/duck/Vietnam/NCVD-1207/2012 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI424973 A/chicken/Vietnam/NCVD-710/2011 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2211/2280 (96%)
EPI424965 A/chicken/Vietnam/NCVD-709/2011 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2211/2280 (96%)
EPI348871 A/duck/Vietnam/NCVD-457/2010 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI348864 A/duck/Vietnam/NCVD-456/2010 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI348857 A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2211/2280 (96%)
EPI348787 A/duck/Vietnam/NCVD-458/2010 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2212/2281 (96%)
EPI348920 A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 1 (PB2) 3825.5 0.000000e+00 2210/2280 (96%)
EPI427347 A/chicken/Vietnam/NCVD-668/2010 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI425768 A/duck/Vietnam/NCVD-671/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI425413 A/duck/Vietnam/NCVD-1306/2012 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2211/2281 (96%)
EPI425293 A/duck/Vietnam/NCVD-669/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI425237 A/duck/Vietnam/NCVD-1171/2012 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2211/2281 (96%)
EPI424829 A/duck/Vietnam/NCVD-711/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI424431 A/chicken/Vietnam/NCVD-705/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI424423 A/chicken/Vietnam/NCVD-704/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI424415 A/chicken/Vietnam/NCVD-703/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI424407 A/chicken/Vietnam/NCVD-702/2011 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI348892 A/duck/Vietnam/NCVD-461/2010 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI348885 A/duck/Vietnam/NCVD-460/2010 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI348878 A/chicken/Vietnam/NCVD-459/2010 (A/H5N1) segment 1 (PB2) 3823.7 0.000000e+00 2210/2280 (96%)
EPI425533 A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 1 (PB2) 3818.1 0.000000e+00 2209/2280 (96%)
EPI424925 A/duck/Vietnam/NCVD-947/2011 (A/H5N1) segment 1 (PB2) 3818.1 0.000000e+00 2209/2280 (96%)
EPI424901 A/duck/Vietnam/NCVD-935/2011 (A/H5N1) segment 1 (PB2) 3818.1 0.000000e+00 2210/2281 (96%)
EPI424853 A/duck/Vietnam/NCVD-1022/2011 (A/H5N1) segment 1 (PB2) 3818.1 0.000000e+00 2210/2281 (96%)
EPI350155 A/chicken/Vietnam/NCVD-390/2009 (A/H5N1) segment 1 (PB2) 3814.5 0.000000e+00 2208/2280 (96%)
EPI427340 A/chicken/Vietnam/NCVD-700/2011 (A/H5N1) segment 1 (PB2) 3812.6 0.000000e+00 2208/2280 (96%)
EPI425880 A/duck/Vietnam/NCVD-1182/2012 (A/H5N1) segment 1 (PB2) 3812.6 0.000000e+00 2209/2281 (96%)
EPI425405 A/duck/Vietnam/NCVD-1269/2012 (A/H5N1) segment 1 (PB2) 3812.6 0.000000e+00 2209/2281 (96%)
EPI424693 A/duck/Vietnam/NCVD-948/2011 (A/H5N1) segment 1 (PB2) 3812.6 0.000000e+00 2208/2280 (96%)
EPI424375 A/duck/Vietnam/NCVD-680/2011 (A/H5N1) segment 1 (PB2) 3812.6 0.000000e+00 2208/2280 (96%)
EPI425613 A/chicken/Vietnam/NCVD-1488/2012 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425493 A/duck/Vietnam/NCVD-931/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425421 A/duck/Vietnam/NCVD-1312/2012 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425341 A/chicken/Vietnam/NCVD-753/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2207/2280 (96%)
EPI425317 A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425053 A/duck/Vietnam/NCVD-760/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425045 A/duck/Vietnam/NCVD-759/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425037 A/duck/Vietnam/NCVD-758/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2208/2281 (96%)
EPI425029 A/duck/Vietnam/NCVD-754/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2207/2280 (96%)
EPI424813 A/duck/Vietnam/NCVD-712/2011 (A/H5N1) segment 1 (PB2) 3807.1 0.000000e+00 2207/2280 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 9:00 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533586 A/Sichuan/26221/2014 (A/H5N6) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI375502 A/Hong Kong/5923/2012 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI347308 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 2 (PB1) 4019.4 0.000000e+00 2241/2274 (98%)
EPI424670 A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI550762 A/duck/Laos/XBY004/2014 (A/H5N6) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI550751 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI531454 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 2 (PB1) 3956.6 0.000000e+00 2231/2275 (98%)
EPI530052 A/duck/Jiangxi/95/2014 (A/H5N6) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI336988 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI336986 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI336985 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI336984 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI336983 A/duck/Zhejiang/224/2011 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI405134 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI425286 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2226/2274 (97%)
EPI425278 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI424894 A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI424886 A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI424942 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI492510 A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI425486 A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI336982 A/duck/Zhejiang/213/2011 (A/H5N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI438913 A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)
EPI424862 A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)
EPI425598 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI425198 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI515011 A/duck/Hunan/749/2011 (A/H0) segment 2 (PB1) 3890.2 0.000000e+00 2219/2275 (97%)
EPI515001 A/duck/Hunan/747/2011 (A/H0) segment 2 (PB1) 3884.6 0.000000e+00 2218/2275 (97%)
EPI475615 A/wild duck/Fujian/2/2011 (A/H5N1) segment 2 (PB1) 3884.6 0.000000e+00 2218/2275 (97%)
EPI425905 A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI351367 A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 2 (PB1) 3884.6 0.000000e+00 2219/2276 (97%)
EPI475601 A/wild duck/Fujian/1/2011 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI425873 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI425865 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI425857 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI425230 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI425142 A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI425102 A/duck/Vietnam/NCVD-1497/2012 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI424734 A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI350490 A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2218/2276 (97%)
EPI350156 A/chicken/Vietnam/NCVD-390/2009 (A/H5N1) segment 2 (PB1) 3879.1 0.000000e+00 2218/2276 (97%)
EPI425174 A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 2 (PB1) 3873.5 0.000000e+00 2216/2275 (97%)
EPI424392 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI350149 A/chicken/Vietnam/NCVD-389/2009 (A/H5N1) segment 2 (PB1) 3873.5 0.000000e+00 2217/2276 (97%)
EPI348921 A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 2 (PB1) 3873.5 0.000000e+00 2217/2276 (97%)
EPI461761 A/duck/Hunan/S4234/2011 (A/H5N1) segment 2 (PB1) 3871.7 0.000000e+00 2215/2275 (97%)
EPI350443 A/chicken/Vietnam/NCVD-399/2010 (A/H5N1) segment 2 (PB1) 3869.9 0.000000e+00 2216/2276 (97%)
EPI531371 A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2217/2277 (97%)
EPI425929 A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2215/2275 (97%)
EPI425769 A/duck/Vietnam/NCVD-671/2011 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2216/2276 (97%)
EPI425678 A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2215/2275 (97%)
EPI425182 A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2215/2275 (97%)
EPI424194 A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2215/2275 (97%)
EPI350436 A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 2 (PB1) 3864.3 0.000000e+00 2215/2276 (97%)
EPI348844 A/duck/Vietnam/NCVD-432/2010 (A/H5N1) segment 2 (PB1) 3864.3 0.000000e+00 2215/2276 (97%)
EPI503721 A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2215/2276 (97%)
EPI461027 A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI459245 A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI459237 A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI425881 A/duck/Vietnam/NCVD-1182/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI425638 A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI425534 A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2215/2276 (97%)
EPI425110 A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424982 A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424974 A/chicken/Vietnam/NCVD-710/2011 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2215/2276 (97%)
EPI424830 A/duck/Vietnam/NCVD-711/2011 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2215/2276 (97%)
EPI424726 A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424702 A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424186 A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424178 A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI424170 A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI348858 A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2215/2276 (97%)
EPI547401 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 2 (PB1) 3856.9 0.000000e+00 2215/2277 (97%)
EPI461486 A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI460930 A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI425921 A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425825 A/chicken/Vietnam/NCVD-1059/2011 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2215/2277 (97%)
EPI425817 A/muscovy duck/Vietnam/NCVD-1049/2011 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2214/2276 (97%)
EPI425686 A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425630 A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425622 A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425494 A/duck/Vietnam/NCVD-931/2011 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425406 A/duck/Vietnam/NCVD-1269/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425310 A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425302 A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425126 A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425022 A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425014 A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI425006 A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI424990 A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI424966 A/chicken/Vietnam/NCVD-709/2011 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2214/2276 (97%)
EPI389928 A/duck/Vietnam/LBM136/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2214/2276 (97%)
EPI389920 A/duck/Vietnam/LBM133/2012 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2214/2276 (97%)
EPI461534 A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2212/2275 (97%)
EPI427348 A/chicken/Vietnam/NCVD-668/2010 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)
EPI425937 A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2212/2275 (97%)
EPI425670 A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)
EPI425646 A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)
EPI425526 A/chicken/Vietnam/NCVD-802/2011 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)
EPI425294 A/duck/Vietnam/NCVD-669/2011 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 9:02 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533587 A/Sichuan/26221/2014 (A/H5N6) segment 3 (PA) 3967.7 0.000000e+00 2150/2151 (99%)
EPI547394 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI424668 A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI461825 A/duck/Hunan/S4220/2011 (A/H5N1) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI375503 A/Hong Kong/5923/2012 (A/H5N1) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI425276 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI405132 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI530053 A/duck/Jiangxi/95/2014 (A/H5N6) segment 3 (PA) 3796.0 0.000000e+00 2119/2151 (98%)
EPI347460 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 3 (PA) 3794.1 0.000000e+00 2109/2137 (98%)
EPI492512 A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI438916 A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI425871 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI425228 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI336995 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI336993 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI336992 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI336991 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI336990 A/duck/Zhejiang/224/2011 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI424884 A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 3 (PA) 3786.8 0.000000e+00 2117/2151 (98%)
EPI425863 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI425855 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI424868 A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI424860 A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI531455 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
EPI424940 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
EPI424892 A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
EPI425596 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 3 (PA) 3773.8 0.000000e+00 2115/2151 (98%)
EPI425196 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 3 (PA) 3773.8 0.000000e+00 2115/2151 (98%)
EPI425903 A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
EPI424390 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
EPI336989 A/duck/Zhejiang/213/2011 (A/H5N1) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
EPI549735 A/duck/Laos/XBY004/2014 (A/H5N6) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI425004 A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI549734 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 3 (PA) 3760.9 0.000000e+00 2112/2150 (98%)
EPI475602 A/wild duck/Fujian/1/2011 (A/H5N1) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
EPI475614 A/wild duck/Fujian/2/2011 (A/H5N1) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI337216 A/Guangxi/1/2009 (A/H5N1) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI280084 A/Guangxi/1/2009 (A/H5N1) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI168039 A/grey heron/Hong Kong/1046/2008 (A/H5N1) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI168055 A/magpie robin/Hong Kong/1897/2008 (A/H5N1) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)
EPI168047 A/magpie robin/Hong Kong/1097/2008 (A/H5N1) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)
EPI168007 A/grey heron/Hong Kong/3088/2007 (A/H5N1) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)
EPI168031 A/great egret/Hong Kong/807/2008 (A/H5N1) segment 3 (PA) 3701.8 0.000000e+00 2102/2151 (97%)
EPI350441 A/chicken/Vietnam/NCVD-399/2010 (A/H5N1) segment 3 (PA) 3679.6 0.000000e+00 2098/2151 (97%)
EPI350488 A/chicken/Vietnam/NCVD-421/2010 (A/H5N1) segment 3 (PA) 3674.1 0.000000e+00 2098/2152 (97%)
EPI350433 A/chicken/Vietnam/NCVD-398/2010 (A/H5N1) segment 3 (PA) 3672.3 0.000000e+00 2096/2151 (97%)
EPI337230 A/Hubei/1/2010 (A/H5N1) segment 3 (PA) 3668.6 0.000000e+00 2096/2151 (97%)
EPI267028 A/Hubei/1/2010 (A/H5N1) segment 3 (PA) 3668.6 0.000000e+00 2096/2151 (97%)
EPI348919 A/duck/Vietnam/NCVD-431/2010 (A/H5N1) segment 3 (PA) 3663.0 0.000000e+00 2095/2151 (97%)
EPI425767 A/duck/Vietnam/NCVD-671/2011 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2095/2152 (97%)
EPI425428 A/duck/Vietnam/NCVD-1207/2012 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2095/2152 (97%)
EPI387934 A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2095/2152 (97%)
EPI350147 A/chicken/Vietnam/NCVD-389/2009 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2094/2151 (97%)
EPI427349 A/chicken/Vietnam/NCVD-668/2010 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI425292 A/duck/Vietnam/NCVD-669/2011 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI424358 A/duck/Vietnam/NCVD-1206/2012 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI351365 A/duck/Vietnam/NCVD-423/2010 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2093/2151 (97%)
EPI424956 A/duck/Vietnam/NCVD-891/2010 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI424948 A/duck/Vietnam/NCVD-890/2010 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI348891 A/duck/Vietnam/NCVD-461/2010 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI348884 A/duck/Vietnam/NCVD-460/2010 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI427342 A/chicken/Vietnam/NCVD-700/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI425532 A/duck/Vietnam/NCVD-815/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2091/2151 (97%)
EPI425500 A/duck/Vietnam/NCVD-946/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI425236 A/duck/Vietnam/NCVD-1171/2012 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI424996 A/duck/Vietnam/NCVD-714/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI424812 A/duck/Vietnam/NCVD-712/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI424382 A/chicken/Vietnam/NCVD-685/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI424374 A/duck/Vietnam/NCVD-680/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2091/2151 (97%)
EPI387927 A/muscovy duck/Vietnam/LBM57/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI387920 A/muscovy duck/Vietnam/LBM14/2011 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI348877 A/chicken/Vietnam/NCVD-459/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI348856 A/duck/Vietnam/NCVD-449/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI348842 A/duck/Vietnam/NCVD-432/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2091/2151 (97%)
EPI539359 A/Viet Nam/CM32/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI515025 A/duck/Hunan/749/2011 (A/H0) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI515022 A/duck/Hunan/747/2011 (A/H0) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI438915 A/chicken/Vietnam/NCVD-675/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI427335 A/chicken/Vietnam/NCVD-686/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI425815 A/muscovy duck/Vietnam/NCVD-1049/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI425556 A/duck/Vietnam/NCVD-645/2010 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI425548 A/duck/Vietnam/NCVD-850/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI425284 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI424964 A/chicken/Vietnam/NCVD-709/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2092/2153 (97%)
EPI424916 A/duck/Vietnam/NCVD-945/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI424828 A/duck/Vietnam/NCVD-711/2011 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2092/2153 (97%)
EPI424366 A/duck/Vietnam/NCVD-664/2010 (A/H5N1) segment 3 (PA) 3635.3 0.000000e+00 2091/2152 (97%)
EPI448035 A/crow/Bangladesh/1019/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI425444 A/duck/Vietnam/NCVD-1219/2012 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI425340 A/chicken/Vietnam/NCVD-753/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI425316 A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI425028 A/duck/Vietnam/NCVD-754/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI424972 A/chicken/Vietnam/NCVD-710/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2091/2153 (97%)
EPI424932 A/chicken/Vietnam/NCVD-752/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI424764 A/duck/Vietnam/NCVD-851/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)
EPI424430 A/chicken/Vietnam/NCVD-705/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2091/2153 (97%)
EPI424422 A/chicken/Vietnam/NCVD-704/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2091/2153 (97%)
EPI424414 A/chicken/Vietnam/NCVD-703/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2091/2153 (97%)
EPI424406 A/chicken/Vietnam/NCVD-702/2011 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2091/2153 (97%)
EPI348863 A/duck/Vietnam/NCVD-456/2010 (A/H5N1) segment 3 (PA) 3629.8 0.000000e+00 2090/2152 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 9:04 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533588 A/Sichuan/26221/2014 (A/H5N6) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%)
EPI424665 A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI347307 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI547403 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 5 (NP) 2649.2 0.000000e+00 1477/1498 (98%)
EPI530064 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI530055 A/duck/Jiangxi/95/2014 (A/H5N6) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI461756 A/duck/Hunan/S4220/2011 (A/H5N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI550764 A/duck/Laos/XBY004/2014 (A/H5N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI550753 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI337009 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI337007 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI337006 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI337004 A/duck/Zhejiang/224/2011 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI531457 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI515015 A/duck/Hunan/749/2011 (A/H0) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI515005 A/duck/Hunan/747/2011 (A/H0) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI337005 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI337003 A/duck/Zhejiang/213/2011 (A/H5N1) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI461764 A/duck/Hunan/S4234/2011 (A/H5N1) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI438143 A/muscovy duck/Vietnam/LBM315/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425681 A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425673 A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425641 A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425625 A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425617 A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425593 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425281 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425193 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI425169 A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424977 A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424937 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424865 A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424857 A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424737 A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424189 A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI424181 A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI405129 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI531380 A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI461023 A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI438151 A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425916 A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425633 A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425305 A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1465/1498 (97%)
EPI425273 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425177 A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425153 A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425137 A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425105 A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI425017 A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1465/1498 (97%)
EPI425009 A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1465/1498 (97%)
EPI424985 A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI424729 A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI424197 A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI424173 A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI503723 A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI460731 A/muscovy duck/Vietnam/LBM335/2013 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI459865 A/muscovy duck/Vietnam/LBM330/2013 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI425932 A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI425924 A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI425665 A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI425297 A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI425265 A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI425129 A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI425097 A/duck/Vietnam/NCVD-1497/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI424721 A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI424713 A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI424705 A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI424697 A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI424681 A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI500774 A/Alberta/01/2014 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI489678 A/tiger/Jiangsu/01/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI475604 A/wild duck/Fujian/1/2011 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI461537 A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI461489 A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI460933 A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI459258 A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI459248 A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI459240 A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI425145 A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI425121 A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI475612 A/wild duck/Fujian/2/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI425868 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI425860 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI425852 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI425481 A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI425225 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI387936 A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI471174 A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI471132 A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI460949 A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1461/1498 (97%)
EPI460941 A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1461/1498 (97%)
EPI424889 A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI424881 A/duck/Vietnam/NCVD-920/2011 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI425900 A/chicken/Vietnam/NCVD-1254/2011 (A/H5N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI425649 A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI375504 A/Hong Kong/5923/2012 (A/H5N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI425001 A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI168049 A/magpie robin/Hong Kong/1097/2008 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI168057 A/magpie robin/Hong Kong/1897/2008 (A/H5N1) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI424387 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jan 17, 2015 9:05 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI533590 A/Sichuan/26221/2014 (A/H5N6) segment 8 (NS) 1509.8 0.000000e+00 821/823 (99%)
EPI461759 A/duck/Hunan/S4220/2011 (A/H5N1) segment 8 (NS) 1498.8 0.000000e+00 819/823 (99%)
EPI347458 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 8 (NS) 1498.8 0.000000e+00 819/823 (99%)
EPI424666 A/duck/Vietnam/NCVD-1940/2012 (A/H5N1) segment 8 (NS) 1493.2 0.000000e+00 818/823 (99%)
EPI375506 A/Hong Kong/5923/2012 (A/H5N1) segment 8 (NS) 1482.1 0.000000e+00 816/823 (99%)
EPI425426 A/duck/Vietnam/NCVD-1207/2012 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI424356 A/duck/Vietnam/NCVD-1206/2012 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI492514 A/barn swallow/Hong Kong/1161/2010 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI425594 A/duck/Vietnam/NCVD-1463/2012 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI425314 A/duck/Vietnam/NCVD-1217/2012 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI425194 A/duck/Vietnam/NCVD129-7/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI425098 A/duck/Vietnam/NCVD-1497/2012 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI425442 A/duck/Vietnam/NCVD-1219/2012 (A/H5N1) segment 8 (NS) 1460.0 0.000000e+00 812/823 (98%)
EPI539364 A/Viet Nam/CM32/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI530067 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI530058 A/duck/Jiangxi/95/2014 (A/H5N6) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI515019 A/duck/Hunan/749/2011 (A/H0) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI515009 A/duck/Hunan/747/2011 (A/H0) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI461026 A/duck/Vietnam/QB1207/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI438273 A/muscovy duck/Vietnam/LBM315/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425933 A/duck/Vietnam/NCVD-1875/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425925 A/duck/Vietnam/NCVD-1544/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425917 A/duck/Vietnam/NCVD-1547/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425682 A/duck/Vietnam/NCVD-1602/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425674 A/duck/Vietnam/NCVD-1593/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425666 A/duck/Vietnam/NCVD-1905/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425650 A/duck/Vietnam/NCVD-1968/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425642 A/duck/Vietnam/NCVD-1936/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425626 A/duck/Vietnam/NCVD-1928/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425306 A/duck/Vietnam/NCVD-1904/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425266 A/duck/Vietnam/NCVD-1901/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425170 A/chicken/Vietnam/NCVD-1942/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425130 A/duck/Vietnam/NCVD-1899/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425122 A/duck/Vietnam/NCVD-1872/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425018 A/duck/Vietnam/NCVD-1884/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424986 A/duck/Vietnam/NCVD-1607/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424978 A/duck/Vietnam/NCVD-1584/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424738 A/duck/Vietnam/NCVD-1932/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424722 A/duck/Vietnam/NCVD-1898/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424714 A/duck/Vietnam/NCVD-1897/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424706 A/duck/Vietnam/NCVD-1896/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424223 A/muscovy duck/Vietnam/LBM230/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424220 A/muscovy duck/Vietnam/LBM229/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424216 A/muscovy duck/Vietnam/LBM228/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI424213 A/muscovy duck/Vietnam/LBM227/2012 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI337030 A/duck/Zhejiang/2248/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI337028 A/duck/Zhejiang/2244/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI337027 A/duck/Zhejiang/2243/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI337026 A/duck/Zhejiang/2242/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI337025 A/duck/Zhejiang/224/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI425298 A/duck/Vietnam/NCVD-1902/2012 (A/H5N1) segment 8 (NS) 1450.7 0.000000e+00 810/823 (98%)
EPI550767 A/duck/Laos/XBY004/2014 (A/H5N6) segment 8 (NS) 1448.9 0.000000e+00 811/824 (98%)
EPI531496 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI503720 A/Japanese white-eye/Taoyuan/Q454/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 811/824 (98%)
EPI489681 A/tiger/Jiangsu/01/2013 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI475609 A/wild duck/Fujian/2/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI475608 A/wild duck/Fujian/1/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI471180 A/muscovy duck/Vietnam/LBM436/2013 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI471154 A/muscovy duck/Vietnam/LBM438/2013 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI460963 A/muscovy duck/Vietnam/LBM398/2013 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI460960 A/muscovy duck/Vietnam/LBM399/2013 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI425618 A/duck/Vietnam/NCVD-1930/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI425282 A/duck/Vietnam/NCVD-674/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 811/824 (98%)
EPI425274 A/duck/Vietnam/NCVD-673/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 811/824 (98%)
EPI425154 A/duck/Vietnam/NCVD-1937/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI425146 A/duck/Vietnam/NCVD-1935/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI425138 A/duck/Vietnam/NCVD-1933/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI425106 A/duck/Vietnam/NCVD-1943/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI424730 A/chicken/Vietnam/NCVD-1927/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI424698 A/duck/Vietnam/NCVD-1869/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI424682 A/duck/Vietnam/NCVD-1974/2012 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI405130 A/duck/Vietnam/NCVD-672/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 811/824 (98%)
EPI337024 A/duck/Zhejiang/213/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI550756 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 8 (NS) 1443.4 0.000000e+00 810/824 (98%)
EPI531375 A/hill myna/Heilongjiang/0704/2012 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 810/824 (98%)
EPI461767 A/duck/Hunan/S4234/2011 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI461543 A/muscovy duck/Vietnam/LBM344/2013 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI461495 A/duck/Quanh Ninh/53/2013 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI460966 A/muscovy duck/Quanh Ninh/49/2013 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI459269 A/muscovy duck/Quanh Ninh/9/2013 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI459266 A/muscovy duck/Quanh Ninh/6/2013 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI425634 A/duck/Vietnam/NCVD-1931/2012 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI425178 A/duck/Vietnam/NCVD-1944/2012 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI424866 A/duck/Vietnam/NCVD-1026/2011 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI424858 A/duck/Vietnam/NCVD-1025/2011 (A/H5N1) segment 8 (NS) 1443.4 0.000000e+00 809/823 (98%)
EPI500775 A/Alberta/01/2014 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI460737 A/muscovy duck/Vietnam/LBM335/2013 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425869 A/duck/Vietnam/NCVD-1163/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425861 A/duck/Vietnam/NCVD-1162/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425853 A/duck/Vietnam/NCVD-1161/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425482 A/duck/Vietnam/NCVD-927/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425226 A/duck/Vietnam/NCVD-1160/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI425010 A/duck/Vietnam/NCVD-1878/2012 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI424938 A/duck/Vietnam/NCVD-885/2010 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI424388 A/duck/Vietnam/NCVD-1283/2012 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI387939 A/muscovy duck/Vietnam/LBM66/2011 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 808/823 (98%)
EPI459329 A/duck/Quanh Ninh/21/2013 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI438277 A/muscovy duck/Vietnam/LBM295/2012 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI425002 A/chicken/Vietnam/NCVD-1437/2012 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI424890 A/chicken/Vietnam/NCVD-921/2011 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 10 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], HilarioR and 53 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group