Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Oct 20, 2017 1:39 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 4 posts ] 
Author Message
PostPosted: Fri Jan 09, 2015 6:45 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Veterinary Department of Cairo University has released a partial H5 sequences from a October 2014 collection from a chicken in Menofia with N159T and E188D (H3 numbering). Glycosylation site not abolished

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jan 09, 2015 6:46 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP209304 344 bp cRNA linear VRL 07-JAN-2015
DEFINITION Influenza A virus (A/chicken/Egypt/FA-7/2014(H5N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION KP209304
VERSION KP209304.1 GI:742688658
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Egypt/FA-7/2014(H5N1))
ORGANISM Influenza A virus (A/chicken/Egypt/FA-7/2014(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 344)
AUTHORS Ismael,E.S., Rohaim,M.A., Gamal,A.R.M., Zaki,M.M., Badawy,M.F.,
Metwally,A.M., Hamoud,H.M., EL-Agrab,H.M., Ali,M.M. and Zahran,O.K.
TITLE Emergence of a novel variant subclade 2.2.1.1 H5N1 avian influenza
virus mixely infected with velogenic NewCastle disease virus in
Egypt during 2014
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 344)
AUTHORS Ismael,E.S., Rohaim,M.A., Gamal,A.R.M., Zaki,M.M., Badawy,M.F.,
Metwally,A.M., Hamoud,H.M., EL-Agrab,H.M., Ali,M.M. and Zahran,O.K.
TITLE Direct Submission
JOURNAL Submitted (26-NOV-2014) Veterinary Hygiene and Management, Faculty
of Veterinary Medicine- Cairo University, Maadi St.105 No. 22,
Maadi, Cairo 12211, Egypt
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..344
/organism="Influenza A virus
(A/chicken/Egypt/FA-7/2014(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Egypt/FA-7/2014"
/serotype="H5N1"
/isolation_source="tracheal homogenate"
/host="layer chicken"
/db_xref="taxon:1577804"
/segment="4"
/country="Egypt: Menofia"
/collection_date="Oct-2014"
/collected_by="Osama K Zahran"
/note="variant 2.2.1.1"
gene <1..>344
/gene="HA"
CDS <1..>344
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJB43518.1"
/db_xref="GI:742688659"
/translation="EWSYIVEKINPANDLCYPGNFNNYEELKHLLSRINRFEKIQIIP
KNSWPDHEASLGVSSACPYQGKPSFYRNVVWLIKKNTTYPTIKESYHNTNQEDLLVLW
GIHHPNDDAEQT"
ORIGIN
1 gaatggtctt acatagtgga gaagatcaat ccagccaatg acctctgtta cccagggaat
61 ttcaacaact atgaagaact gaaacaccta ttgagcagaa taaaccggtt tgagaaaatt
121 cagatcatcc ccaaaaattc ttggccagac catgaagcct cattaggagt gagctcagca
181 tgcccatacc agggaaaacc ctccttttat agaaatgtgg tatggcttat caaaaagaac
241 actacatacc caacaataaa ggaaagctac cataatacca atcaagaaga tcttttggtg
301 ctgtggggga tccaccatcc aaatgatgat gcagagcaga caag

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jan 09, 2015 7:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Glycosylation site at position 158 is present.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jan 09, 2015 7:08 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI398382 A/chicken/Sharkia/CAI38/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI398238 A/chicken/Sharkia/CAI3/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI310239 A/chicken/Egypt/F10/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI287366 A/chicken/Egypt/3982-4/2010 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 330/338 (97%)
EPI287354 A/chicken/Egypt/1553-28/2010 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 330/338 (97%)
EPI245995 A/chicken/Egypt/09277s-NLQP/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI214893 A/chicken/Egypt/0977-NLQP/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI214891 A/chicken/Egypt/096767V-NLQP/2009 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI173589 A/chicken/Egypt/3NLQP-CLEVB325/2008 (A/H5N1) segment 4 (HA) 581.0 2.427516e-164 334/344 (97%)
EPI287359 A/chicken/Egypt/2095-65/2010 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 329/338 (97%)
EPI283780 A/chicken/Egypt/095941v/2009 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI246015 A/chicken/Egypt/095941v-NLQP/2009 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI214903 A/duck/Egypt/0955-NLQP/2009 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI214890 A/chicken/Egypt/0963S-NLQP/2009 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI214888 A/chicken/Egypt/096293V-NLQP/2009 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI182350 A/chicken/Egypt/0876-NLQP/2008 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI173588 A/chicken/Egypt/2NLQP-CLEVB330/2008 (A/H5N1) segment 4 (HA) 575.4 1.129413e-162 333/344 (96%)
EPI398230 A/duck/El Fayoum/CAI1/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI398164 A/duck/El Fayoum/CAI9/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI352540 A/chicken/Egypt/1/2009 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI315696 A/chicken/Egypt/G3H4-NLQP/2008 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI287378 A/chicken/Egypt/3982-50/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI287376 A/chicken/Egypt/3982-43/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 333/345 (96%)
EPI287371 A/chicken/Egypt/3982-13/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 328/338 (97%)
EPI287365 A/chicken/Egypt/3982-3/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 328/338 (97%)
EPI287357 A/chicken/Egypt/2095-49/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 328/338 (97%)
EPI287356 A/chicken/Egypt/2095-46/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 328/338 (97%)
EPI287350 A/chicken/Egypt/1553-6/2010 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI283779 A/chicken/Egypt/095723v/2009 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI245998 A/chicken/Egypt/09567s-NLQP/2009 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI214897 A/duck/Egypt/09244F-NLQP/2009 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI182353 A/chicken/Egypt/0880-NLQP/2008 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI173593 A/chicken/Egypt/7NLQP-CLEVB305/2008 (A/H5N1) segment 4 (HA) 569.9 5.254650e-161 332/344 (96%)
EPI493519 A/chicken/Egypt/Q1397D/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI493222 A/chicken/Egypt/Q1182E/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI493160 A/chicken/Egypt/Q1769B/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI493084 A/chicken/Egypt/Q1118D/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398357 A/chicken/Giza/CAI24/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398342 A/chicken/Giza/CAI22/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 332/345 (96%)
EPI398318 A/chicken/Qalubia/CAI19/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398270 A/chicken/Giza/CAI8/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398262 A/chicken/Giza/CAI7/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398246 A/chicken/Qalubia/CAI5/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398197 A/chicken/Menofia/CAI30/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI398173 A/chicken/Sharkia/CAI16/2009 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 332/345 (96%)
EPI369182 A/chicken/Egypt/113Q/2011 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 321/329 (97%)
EPI352543 A/chicken/Egypt/Q1182/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI318208 A/chicken/Egypt/RIMD11-1/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI314393 A/chicken/Damietta/113/2007 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI314354 A/chicken/Dakahlia/110/2007 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI287355 A/chicken/Egypt/2095-39/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI287353 A/chicken/Egypt/1553-26/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI267066 A/chicken/Israel/65/2010 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 327/338 (96%)
EPI257057 A/chicken/Egypt/35-3/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI245990 A/chicken/Egypt/0962-NLQP/2009 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI245980 A/chicken/Egypt/0882-NLQP/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI214886 A/chicken/Egypt/09568S-NLQP/2009 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI214885 A/chicken/Egypt/09534S-NLQP/2009 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI214884 A/chicken/Egypt/09519S-NLQP/2009 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI182352 A/chicken/Egypt/0879-NLQP/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI173592 A/chicken/Egypt/6NLQP-CLEVB306/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI173587 A/chicken/Egypt/1NLQP-CLEVB331/2008 (A/H5N1) segment 4 (HA) 564.3 2.444751e-159 331/344 (96%)
EPI165072 A/Egypt/3300-NAMRU3/2008 (A/H5N1) segment 4 (HA) 562.5 8.792888e-159 330/344 (95%)
EPI398302 A/chicken/Giza/CAI15/2008 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 329/342 (96%)
EPI398213 A/chicken/Sharkia/CAI41/2009 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 329/342 (96%)
EPI398186 A/chicken/Menofia/CAI28/2009 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 329/342 (96%)
EPI398181 A/chicken/Sharkia/CAI27/2009 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 329/342 (96%)
EPI287363 A/chicken/Egypt/2095-75/2010 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 330/344 (95%)
EPI287361 A/chicken/Egypt/2095-70/2010 (A/H5N1) segment 4 (HA) 560.7 3.162485e-158 330/344 (95%)
EPI493386 A/chicken/Egypt/Q1112E/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI398334 A/chicken/Qalubia/CAI21/2008 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI398294 A/chicken/Qalubia/CAI14/2008 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI398221 A/chicken/Menofia/CAI43/2009 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI352542 A/chicken/Egypt/Q1185/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 331/345 (95%)
EPI352541 A/chicken/Egypt/Q1011/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 331/345 (95%)
EPI287382 A/chicken/Egypt/3982-78/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI287379 A/chicken/Egypt/3982-52/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 331/345 (95%)
EPI287372 A/chicken/Egypt/3982-14/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI287360 A/chicken/Egypt/2095-68/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI283823 A/chicken/Egypt/10159s/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI283801 A/chicken/Egypt/1052s/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI246016 A/chicken/Egypt/1052S-NLQP/2010 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI182346 A/chicken/Egypt/0865-NLQP/2008 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI182338 A/chicken/Egypt/0837-NLQP/2008 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI181993 A/chicken/Egypt/0836/2008 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI136757 A/chicken/Egypt/07202-NLQP/2007 (A/H5N1) segment 4 (HA) 558.8 1.137432e-157 330/344 (95%)
EPI493321 A/chicken/Egypt/Q1090E/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 330/345 (95%)
EPI493175 A/chicken/Egypt/Q1184B/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI340176 A/chicken/Egypt/1041AG/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 330/345 (95%)
EPI340163 A/chicken/Egypt/1098/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI339154 A/chicken/Egypt/VSVRI/2009 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI318202 A/chicken/Egypt/RIMD4-3/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI314630 A/chicken/Dakahlia/108/2009 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 330/345 (95%)
EPI287375 A/duck/Egypt/3982-21/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI287362 A/chicken/Egypt/2095-73/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 330/345 (95%)
EPI287351 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI283824 A/chicken/Egypt/10265s/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI283809 A/chicken/Egypt/10116s/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI283802 A/chicken/Egypt/10127s/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI283797 A/chicken/Egypt/1063/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI257053 A/chicken/Egypt/6-A/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 327/340 (96%)
EPI257052 A/chicken/Egypt/8-C/2010 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 330/345 (95%)
EPI254432 A/chicken/Egypt/496N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI254430 A/chicken/Egypt/492N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI254429 A/chicken/Egypt/490N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI254428 A/chicken/Egypt/489N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI251453 A/reassortant/IDCDC-RG13(Egypt/3300-NAMRU3/2008 x Puerto Rico/8/1934) (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI182362 A/chicken/Egypt/08194S-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI182361 A/chicken/Egypt/08139S-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI182347 A/chicken/Egypt/0869h3-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI182345 A/chicken/Egypt/0859-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI182341 A/chicken/Egypt/0845-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI173602 A/chicken/Egypt/20NLQP-CLEVB238/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI173601 A/chicken/Egypt/18NLQP-CLEVB240/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI173599 A/chicken/Egypt/16NLQP-CLEVB242/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI159887 A/chicken/Egypt/1709-8VIR08/2007 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI153489 A/chicken/Egypt/1709-6/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI153488 A/chicken/Egypt/1709-5/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI147497 A/chicken/Egypt/9402NAMRU3-CLEVB213/2007 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI141221 A/chicken/Israel/1055/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI136775 A/chicken/Egypt/088S-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI136773 A/chicken/Egypt/086Q-NLQP/2008 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI136771 A/chicken/Egypt/07701S-NLQP/2007 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI136755 A/chicken/Egypt/07201-NLQP/2007 (A/H5N1) segment 4 (HA) 553.3 5.291956e-156 329/344 (95%)
EPI136767 A/chicken/Egypt/07632S-NLQP/2007 (A/H5N1) segment 4 (HA) 549.6 6.845577e-155 327/342 (95%)
EPI493452 A/chicken/Egypt/Q1089E/2010 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 329/345 (95%)
EPI398326 A/chicken/Qalubia/CAI20/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI398191 A/chicken/Menofia/CAI29/2009 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI373010 A/chicken/Egypt/9403-NAMRU3/2007 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 329/345 (95%)
EPI340166 A/chicken/Egypt/10112SG/2010 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI340145 A/chicken/Egypt/10512AG/2010 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI315694 A/chicken/Egypt/083-NLQP/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI314704 A/chicken/Dakahlia/115/2009 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI314512 A/chicken/Dakahlia/106/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI287383 A/poultry/Egypt/4794-17/2010 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI283806 A/chicken/Egypt/1071g/2010 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 329/345 (95%)
EPI257061 A/chicken/Egypt/18-H/2009 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 330/346 (95%)
EPI257056 A/chicken/Egypt/36-4/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI254431 A/chicken/Egypt/495N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI254427 A/chicken/Egypt/488N3-CLEVB/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI190428 A/chicken/Egypt/083/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI182335 A/chicken/Egypt/0815-NLQP/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 329/345 (95%)
EPI173605 A/chicken/Egypt/24NLQP-CLEVB227/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI173604 A/chicken/Egypt/23NLQP-CLEVB231/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI173596 A/chicken/Egypt/13NLQP-CLEVB261/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI173591 A/chicken/Egypt/5NLQP-CLEVB307/2008 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 328/344 (95%)
EPI147498 A/chicken/Egypt/9403NAMRU3-CLEVB214/2007 (A/H5N1) segment 4 (HA) 547.7 2.462108e-154 329/345 (95%)
EPI493571 A/chicken/Egypt/Q1995A/2010 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI398367 A/chicken/Menofia/CAI35/2010 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI398349 A/chicken/Giza/CAI23/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI398286 A/chicken/Qalubia/CAI12/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI398254 A/chicken/Giza/CAI6/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI340171 A/chicken/Egypt/10158SF/2010 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 328/345 (95%)
EPI338617 A/chicken/Egypt/Q1995D/2010 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI314628 A/chicken/Dakahlia/114/2009 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 328/345 (95%)
EPI314458 A/chicken/Dakahlia/122/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 328/345 (95%)
EPI257058 A/chicken/Egypt/34-2/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI253928 A/chicken/Egypt/1/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI246013 A/goose/Egypt/0946smL-NLQP/2009 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 328/345 (95%)
EPI214936 A/turkey/Egypt/091Q-NLQP/2009 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 328/345 (95%)
EPI214892 A/chicken/Egypt/0975-NLQP/2009 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI173600 A/chicken/Egypt/17NLQP-CLEVB241/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI173595 A/chicken/Egypt/10NLQP-CLEVB299/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI173594 A/chicken/Egypt/8NLQP-CLEVB304/2008 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI136759 A/turkey/Egypt/07203-NLQP/2007 (A/H5N1) segment 4 (HA) 542.2 1.145507e-152 327/344 (95%)
EPI318230 A/chicken/Egypt/RIMD28-1/2009 (A/H5N1) segment 4 (HA) 540.3 4.119977e-152 326/343 (95%)
EPI318213 A/chicken/Egypt/RIMD27-2/2009 (A/H5N1) segment 4 (HA) 540.3 4.119977e-152 326/343 (95%)
EPI318210 A/chicken/Egypt/RIMD21-2/2009 (A/H5N1) segment 4 (HA) 540.3 4.119977e-152 326/343 (95%)
EPI182337 A/chicken/Egypt/0831-NLQP/2008 (A/H5N1) segment 4 (HA) 540.3 4.119977e-152 326/343 (95%)
EPI493577 A/chicken/Egypt/Q2247B/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI493246 A/chicken/Egypt/Q2247A/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI398390 A/chicken/Menofia/CAI39/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI398375 A/chicken/Menofia/CAI36/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI398278 A/chicken/Menofia/CAI10/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI348161 A/chicken/Egypt/11VIR4453-9/VRLCU/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI340172 A/chicken/Egypt/1085/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI340105 A/chicken/Egypt/116AD/2011 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI314626 A/duck/Dakahlia/123/2009 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI314550 A/chicken/Dakahlia/111/2008 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI314549 A/chicken/Dakahlia/105/2008 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI287384 A/poultry/Egypt/4794-18/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI283787 A/duck/Egypt/1017/2010 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI182344 A/chicken/Egypt/0855-NLQP/2008 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI173597 A/chicken/Egypt/14NLQP-CLEVB255/2008 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 327/345 (94%)
EPI173590 A/chicken/Egypt/4NLQP-CLEVB308/2008 (A/H5N1) segment 4 (HA) 536.6 5.329527e-151 326/344 (94%)
EPI318231 A/chicken/Egypt/RIMD29-3/2009 (A/H5N1) segment 4 (HA) 534.8 1.916839e-150 325/343 (94%)
EPI318212 A/chicken/Egypt/RIMD26-3/2009 (A/H5N1) segment 4 (HA) 534.8 1.916839e-150 325/343 (94%)
EPI318209 A/chicken/Egypt/RIMD13-1/2008 (A/H5N1) segment 4 (HA) 534.8 1.916839e-150 325/343 (94%)
EPI283794 A/chicken/Egypt/1042/2010 (A/H5N1) segment 4 (HA) 533.0 6.894178e-150 326/344 (94%)
EPI348164 A/chicken/Egypt/11VIR4453-18/VRLCU/2010 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI340175 A/chicken/Egypt/10909V/2010 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI340108 A/chicken/Egypt/115AD/2011 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 325/344 (94%)
EPI336863 A/turkey/Israel/362/2011 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI283816 A/chicken/Egypt/10135ss/2010 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI283783 A/chicken/Egypt/1050ss/2010 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI257060 A/chicken/Egypt/20-16/2009 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 329/348 (94%)
EPI257055 A/chicken/Egypt/37-1/2008 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 327/346 (94%)
EPI245994 A/chicken/Egypt/096L-NLQP/2009 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI214878 A/chicken/Egypt/0910QL-NLQP/2009 (A/H5N1) segment 4 (HA) 531.1 2.479588e-149 326/345 (94%)
EPI318211 A/chicken/Egypt/RIMD25-1/2009 (A/H5N1) segment 4 (HA) 529.3 8.918183e-149 324/343 (94%)
EPI287373 A/chicken/Egypt/3982-19/2010 (A/H5N1) segment 4 (HA) 527.4 3.207549e-148 325/345 (94%)
EPI314362 A/chicken/Egypt/CL6/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI283804 A/turkey/Egypt/101474v/2010 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI283796 A/chicken/Egypt/1055/2010 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 326/346 (94%)
EPI283790 A/chicken/Egypt/1031/2010 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI271854 A/chicken/Egypt/C3Br11/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI259573 A/chicken/Egypt/C1Li9/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI259572 A/chicken/Egypt/C1Lu2/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI259571 A/chicken/Egypt/C1Tr13/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI259569 A/duck/Egypt/D3Lu6/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI214883 A/chicken/Egypt/09359S-NLQP/2009 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI127726 A/chicken/Egypt/3052NAMRU3-CLEVB104/2007 (A/H5N1) segment 4 (HA) 525.6 1.153640e-147 325/345 (94%)
EPI398310 A/chicken/Giza/CAI17/2009 (A/H5N1) segment 4 (HA) 520.0 5.367364e-146 324/345 (93%)
EPI314382 A/chicken/Gharbia/101/2007 (A/H5N1) segment 4 (HA) 520.0 5.367364e-146 323/344 (93%)
EPI153485 A/chicken/Egypt/1709-1VIR08/2007 (A/H5N1) segment 4 (HA) 520.0 5.367364e-146 324/345 (93%)
EPI127734 A/chicken/Egypt/9385NAMRU3-CLEVB125/2007 (A/H5N1) segment 4 (HA) 520.0 5.367364e-146 323/344 (93%)
EPI314404 A/chicken/Dakahlia/118/2007 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 322/344 (93%)
EPI244424 A/turkey/Egypt/7/2007 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI225079 A/duck/Gaza/834/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI225077 A/duck/Gaza/760/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI225076 A/duck/Egypt/2253-3/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI225068 A/duck/Egypt/2253-3/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI214879 A/chicken/Egypt/0918Q-NLQP/2009 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI174742 A/Guinea fowl/Constanta/RO-AI-159/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 322/344 (93%)
EPI136749 A/chicken/Egypt/06612-NLQP/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI127764 A/chicken/Egypt/06495-NLQP/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI127762 A/chicken/Egypt/06459-3-NLQP/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI127736 A/chicken/Egypt/9386NAMRU3-CLEVB136/2007 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 322/344 (93%)
EPI116422 A/chicken/Israel/625/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI116418 A/turkey/Israel/446/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI115436 A/goose/Egypt/13009N3-SM2/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI115432 A/duck/Egypt/13010N3-CLEVB/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI115430 A/duck/Egypt/12380N3-CLEVB/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI110243 A/Egypt/5494-NAMRU3/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI106177 A/Turkey/Egypt/5613NAMRU3-T/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI14172 A/chicken/Nigeria/SO457/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI14058 A/chicken/Nigeria/SO493/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI14048 A/chicken/Nigeria/SO457/2006 (A/H5N1) segment 4 (HA) 514.5 2.497192e-144 323/345 (93%)
EPI460393 A/chicken/Egypt/0626/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI314421 A/chicken/Dakahlia/107/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI314371 A/chicken/Gharbia/124/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 321/344 (93%)
EPI305586 A/Chicken/Turkey-Mardin/09rs2841-107/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI305585 A/Chicken/Turkey-Siirt/09rs2841-105/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI305584 A/Chicken/Turkey-Siirt/09rs2841-104/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI293944 A/Chicken/Turkey-Bitlis/09rs2841-93/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI259646 A/duck/Egypt/D1Li4/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI259645 A/duck/Egypt/D1Br12/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI259644 A/duck/Egypt/D1Tr335/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI233772 A/chicken/Nigeria/08RS848-6/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI227150 A/duck/Novosibirsk/02/05 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI224959 A/chicken/Gaza/450/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI156776 A/duck/Egypt/5169-4/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI156731 A/duck/Egypt/452-1VIR07/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI153757 A/egret/Egypt/1162-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI153487 A/chicken/Egypt/1709-4VIR08/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI152329 A/chicken/Nigeria/228-5/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI152321 A/chicken/Nigeria/228-6/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI152313 A/chicken/Nigeria/228-10/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI136765 A/turkey/Egypt/07444S-NLQP/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI136751 A/quail/Egypt/07120-NLQP/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI136747 A/chicken/Egypt/06553-NLQP/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127772 A/chicken/Egypt/452-2/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127754 A/turkey/Egypt/9398NAMRU3-CLEVB195/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127752 A/chicken/Egypt/9397NAMRU3-CLEVB188/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127750 A/chicken/Egypt/9396NAMRU3-CLEVB187/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127746 A/chicken/Egypt/9391NAMRU3-CLEVB158/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 321/344 (93%)
EPI127744 A/chicken/Egypt/9390NAMRU3-CLEVB157/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 321/344 (93%)
EPI127740 A/chicken/Egypt/9388NAMRU3-CLEVB149/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127720 A/chicken/Egypt/3049NAMRU3-CLEVB75/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI127710 A/chicken/Egypt/3044NAMRU3-CLEVB59/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI125652 A/chicken/Egypt/R1/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI125642 A/turkey/Egypt/F2/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI124612 A/Egypt/902786/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI124608 A/chicken/Egypt/3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI122751 A/Egypt/2992-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI122749 A/Egypt/2991-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI118798 A/Turkey/12/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI116460 A/Egypt/2256-NAMRU3/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI116454 A/Egypt/1604-NAMRU3/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI116414 A/turkey/Israel/365/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI116412 A/turkey/Israel/364/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI116410 A/turkey/Israel/345/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115440 A/chicken/Egypt/1892N3-HK49/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115434 A/duck/Egypt/1888N3-SM25/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115426 A/chicken/Egypt/1889N3-SM26/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115422 A/chicken/Egypt/12378N3-CLEVB/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115420 A/chicken/Egypt/1129N3-HK9/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115083 A/chicken/Egypt/1300-NAMRU3/2007 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115081 A/chicken/Egypt/1081-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI115075 A/chicken/Egypt/1078-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI114796 A/chicken/Omsk/14/05 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110247 A/chicken/Egypt/10845-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110239 A/Egypt/3105-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110237 A/Egypt/2947-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110235 A/Egypt/2786-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110233 A/Egypt/2783-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI110231 A/Egypt/2763-NAMRU3/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI106348 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI103018 A/chicken/Egypt/960N3-004/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI58619 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14180 A/chicken/Nigeria/SO485/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14178 A/chicken/Nigeria/SO478/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14176 A/chicken/Nigeria/SO470/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14170 A/chicken/Nigeria/SO294/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14168 A/chicken/Nigeria/SO227/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14056 A/chicken/Nigeria/SO485/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14054 A/chicken/Nigeria/SO478/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14052 A/chicken/Nigeria/SO470/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14044 A/chicken/Nigeria/SO300/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14042 A/chicken/Nigeria/SO294/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI14040 A/chicken/Nigeria/SO227/2006 (A/H5N1) segment 4 (HA) 508.9 1.161830e-142 322/345 (93%)
EPI174755 A/chicken/Bacau/RO-AI-527/2006 (A/H5N1) segment 4 (HA) 507.1 4.178685e-142 321/344 (93%)
EPI156746 A/chicken/Egypt/2628-2/2007 (A/H5N1) segment 4 (HA) 505.3 1.502922e-141 321/345 (93%)
EPI127748 A/chicken/Egypt/9392NAMRU3-CLEVB167/2007 (A/H5N1) segment 4 (HA) 505.3 1.502922e-141 320/344 (93%)
EPI382223 A/chicken/Pakistan-Lhr/NARC-610/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI356784 A/chicken/Turkey/Hilvan ist271/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI323284 A/chicken/Lahore/NARC-3320/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI321391 A/chicken/Pakistan/SPVC-8/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI321389 A/chicken/Pakistan/SPVC-8/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI321377 A/chicken/Pakistan/SPVC-1/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI321375 A/chicken/Pakistan/NARC-228/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI318206 A/chicken/Egypt/RIMD9-2/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI318205 A/chicken/Egypt/RIMD8-14/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI318200 A/chicken/Egypt/RIMD2-6/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI314384 A/chicken/Gharbia/112/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI314373 A/chicken/Dakahlia/120/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI314356 A/chicken/Dakahlia/117/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI314352 A/chicken/Dakahlia/121/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI314342 A/duck/Egypt/D2br10/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305616 A/Sparrow/Turkey-Batman/09rs2842-104/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305615 A/Owl/Turkey-Tunceli/09rs2841-102/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305612 A/Pigeon/Turkey-Karabuk/09rs2841-61/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305609 A/Pigeon/Turkey-Bitlis/09rs2841-11/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305601 A/Chicken/Turkey-Batman/09rs2842-109/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305599 A/Chicken/Turkey-Diyarbakir/09rs2842-100/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305598 A/Chicken/Turkey-Batman/09rs2842-96/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305597 A/Chicken/Turkey-Diyarbakir/09rs2842-94/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305596 A/Turkey/Turkey/Diyarbakir/09rs2842-93/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305595 A/Chicken/Turkey-Diyarbakir/09rs2842-91/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305594 A/Chicken/Turkey-Batman/09rs2842-90/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI305582 A/Chicken/Turkey-Tunceli/09rs2841-101/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305580 A/Chicken/Turkey-Mus/09rs2841-94/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305578 A/Chicken/Turkey-Malatya/09rs2841-90/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305570 A/Chicken/Turkey-Gaziantep/09rs2841-81/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305569 A/Chicken/Turkey-Sanliurfa/09rs2841-80/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305561 A/Chicken/Turkey-Mus/09rs2841-65/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305557 A/Chicken/Turkey-Mugla/09rs2841-54/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305556 A/Chicken/Turkey-Elazi/09rs2841-52/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305555 A/Avian/Turkey-Erzurum/09rs2841-46/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305549 A/Chicken/Turkey-Yozgat/09rs2841-26/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305546 A/Chicken/Turkey-Agri/09rs2841-22/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305544 A/Duck/Turkey-Igdir/09rs2841-20/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305543 A/Goose/Turkey-Agri/09rs2841-17/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305542 A/Chicken/Turkey-Igdir/09rs2841-14/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305541 A/Chicken/Turkey-Agri/09rs2841-12/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI305540 A/Chicken/Turkey-Agri/09rs2841-10/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI293952 A/Chicken/Turkey-Batman/09rs2842-92/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI293928 A/Chicken/Turkey-Mus/09rs2841-51/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI293920 A/Chicken/Turkey-Mus/09rs2841-50/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI293904 A/Pigeon/Turkey-Agri/09rs2841-8/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI293896 A/Pigeon/Turkey-Kars/09rs2841-7/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI280128 A/Xinjiang/1/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI276062 A/pied megpie/Liaoning/7/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI275806 A/chicken/Liaoning/23/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI259570 A/duck/Egypt/D3Li12/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI259568 A/duck/Egypt/D2Li234/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI259567 A/duck/Egypt/D2Br210/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI255357 A/Egypt/7021-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI245983 A/duck/Egypt/08355S-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI245981 A/chicken/Egypt/0883-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI233892 A/chicken/Nigeria/08RS848-8/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI233708 A/chicken/Nigeria/08RS848-47/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI233700 A/chicken/Nigeria/08RS848-45/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI233612 A/chicken/Nigeria/08RS848-26/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI227594 A/Bar headed goose/Qinghai/1A/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI226653 A/Chicken/Palembang/BPPV-III/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI225792 A/wild goose/Olt/RO-AI-288/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI225089 A/duck/Hungary/11804/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI225064 A/domestic poultry/Egypt/906089/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI225037 A/chicken/Reshoty/02/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI224963 A/chicken/Gaza/714/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI224961 A/chicken/Gaza/713/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI214887 A/chicken/Egypt/0960-NLQP/2009 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 320/344 (93%)
EPI184642 A/mute swan/France/070203/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI184079 A/goose/Hungary/14756/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182359 A/chicken/Egypt/0875S-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182358 A/duck/Egypt/0845S-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182349 A/duck/Egypt/0875-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182339 A/chicken/Egypt/0838-NLQP/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182330 A/chicken/Egypt/07480S-NLQP/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182329 A/chicken/Egypt/07175-NLQP/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI182328 A/chicken/Egypt/07118-NLQP/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI181639 A/chicken/East Java/UT6023/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI181637 A/chicken/East Java/UT6017/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI181303 A/Xinjiang/1/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI165075 A/Egypt/10215-NAMRU3/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI164652 A/goosander/Sweden/V539/06 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI164642 A/tufted duck/Sweden/V526/06 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI160881 A/chicken/Nigeria/OG2/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI156821 A/swan/Poland/467-136V08/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI156786 A/duck/Egypt/5169-6/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI156784 A/chicken/Egypt/5169-5/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI156750 A/chicken/Egypt/2628-4/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI156748 A/chicken/Egypt/2628-3/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI154914 A/chicken/Egypt/1709-2/2008 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI136779 A/chicken/Egypt/07125-NLQP/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI136769 A/chicken/Egypt/07665S-NLQP/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127776 A/duck/Egypt/5169-1/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127768 A/chicken/Egypt/06959-NLQP/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127760 A/chicken/Egypt/06207-NLQP/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127756 A/duck/Egypt/9399NAMRU3-CLEVB202/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127714 A/chicken/Egypt/3046NAMRU3-CLEVB62/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI127712 A/chicken/Egypt/3045NAMRU3-CLEVB60/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI126326 A/environment/Korea/W150/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI125648 A/duck/Egypt/F5/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI125646 A/chicken/Egypt/F4/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI125644 A/chicken/Egypt/F3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI125640 A/turkey/Egypt/F1/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI124881 A/chicken/Nigeria/1071-22/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI124636 A/chicken/Egypt/2/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI124634 A/chicken/Egypt/1/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI124610 A/Egypt/902782/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI118835 A/Turkey/65596/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI118816 A/Turkey/651242/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI118814 A/Turkey/15/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI116456 A/Egypt/1731-NAMRU3/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI116416 A/chicken/Israel/397/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI115424 A/chicken/Egypt/12379N3-CLEVB/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI115085 A/duck/Egypt/1301-NAMRU3/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI115079 A/chicken/Egypt/1080-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI115077 A/chicken/Egypt/1079-NAMRU3/2007 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114806 A/chicken/Tula/4/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114802 A/turkey/Suzdalka/12/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114798 A/goose/Suzdalka/10/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114794 A/chicken/Suzdalka/06/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114792 A/Egypt/14725-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI114790 A/Egypt/14724-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI110257 A/Egypt/12374-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI110245 A/Egypt/5614-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI110241 A/Egypt/3458-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI107841 A/Guinea fowl/Shantou/1341/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI106418 A/wild duck/Omsk/103-01/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI106408 A/chicken/Tambov/570-2/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI106175 A/Chicken/Egypt/5612NAMRU3-S/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI106173 A/Chicken/Egypt/5611NAMRU3-AN/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI106171 A/Chicken/Egypt/5610NAMRU3-F3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI105714 A/chicken/Dovolnoe/03/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI105628 A/Djibouti/5691NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI105596 A/chicken/Crimea/08/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI105588 A/chicken/Crimea/04/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI103091 A/Egypt/2782-NAMRU3/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI103004 A/cygnus cygnus/Iran/754/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI102990 A/domestic goose/Iraq/812/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI102988 A/domestic cat/Iraq/820/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI100494 A/Environment/Qinghai/31/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI100492 A/migratory duck/Jiangxi/2300/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI100488 A/migratory duck/Jiangxi/2136/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97708 A/great black-headed gull/Qinghai/1/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97706 A/black-headed gull/Qinghai/1/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97704 A/black-headed goose/Qinghai/2/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97702 A/black-headed goose/Qinghai/1/2005 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97197 A/Bar-headed Goose/Qinghai/67/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97195 A/Bar-headed Goose/Qinghai/65/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97193 A/Bar-headed Goose/Qinghai/12/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97191 A/Bar-headed Goose/Qinghai/62/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97189 A/Bar-headed Goose/Qinghai/75/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97187 A/Bar-headed Goose/Qinghai/61/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97185 A/Bar-headed Goose/Qinghai/5/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97183 A/Brown-headed Gull/Qinghai/3/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97181 A/Bar-headed Goose/Qinghai/60/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97179 A/Great Black-headed Gull/Qinghai/2/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97177 A/Bar-headed Goose/Qinghai/68/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI97175 A/Bar-headed Goose/Qinghai/59/05 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI58638 A/turkey/Egypt/2253-2/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI47447 A/chicken/Nigeria/1047-54/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI14348 A/chicken/Nigeria/AB14/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI14346 A/chicken/Nigeria/AB13/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI14256 A/Canada goose/Germany/R1207/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 321/345 (93%)
EPI14174 A/chicken/Nigeria/SO461/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI14096 A/chicken/Nigeria/SO494/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI14050 A/chicken/Nigeria/SO461/2006 (A/H5N1) segment 4 (HA) 503.4 5.405471e-141 322/346 (93%)
EPI225332 A/owl/Constanta/RO-AI-351/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI225061 A/domestic goose/RO-AI-373/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174756 A/chicken/Giurgiu/RO-AI-575/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174753 A/domestic duck/Bucharest/RO-AI-485/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174752 A/domestic duck/Bucharest/RO-AI-482/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174751 A/chicken/Valcea/RO-AI-479/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174750 A/chicken/Covasna/RO-AI-379/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174748 A/chicken/Brasov/RO-AI-354/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI174746 A/chicken/Brasov/RO-AI-350/2006 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI127730 A/chicken/Egypt/9383NAMRU3-CLEVB112/2007 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/345 (92%)
EPI127722 A/quail/Egypt/3050NAMRU3-CLEVB77/2007 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI106410 A/goose/Crimea/615/05 (A/H5N1) segment 4 (HA) 501.6 1.944153e-140 320/344 (93%)
EPI340162 A/duck/Egypt/10255AG/2010 (A/H5N1) segment 4 (HA) 499.7 6.992418e-140 320/344 (93%)
EPI533400 A/chicken/West Java/A/2003 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 321/346 (92%)
EPI533371 A/chicken/Indonesia/2A/2003 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 322/347 (92%)
EPI533370 A/chicken/Indonesia/BL/2003 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 321/346 (92%)
EPI504985 A/duck/Egypt/BSU-BS-R7/2008 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 318/342 (92%)
EPI382220 A/chicken/Pakistan-Khi/NARC-520/2008 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 321/346 (92%)
EPI357032 A/chicken/Turkey/Goncaaydin ist982/2006 (A/H5N1) segment 4 (HA) 497.9 2.514921e-139 320/345 (92%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 4 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 55 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group