Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 7:29 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 5 posts ] 
Author Message
PostPosted: Wed Dec 31, 2014 8:01 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
USDA October 2014 Indiana Swine Match 2012 H3N2v Cases

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:01 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP186022 1701 bp cRNA linear VRL 17-DEC-2014
DEFINITION Influenza A virus (A/swine/Indiana/A01476743/2014(H3N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP186022
VERSION KP186022.1 GI:732548639
KEYWORDS .
SOURCE Influenza A virus (A/swine/Indiana/A01476743/2014(H3N2))
ORGANISM Influenza A virus (A/swine/Indiana/A01476743/2014(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Olson,W.J. and Zhang,J.
CONSRTM USDA SIV Survelliance
TITLE Direct Submission
JOURNAL Submitted (21-NOV-2014) National Veterinary Services Labortary,
USDA, 1920 Dayton Ave., Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Indiana/A01476743/2014(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Indiana/A01476743/2014"
/serotype="H3N2"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1574581"
/segment="4"
/country="USA: Indiana"
/collection_date="14-Oct-2014"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIZ70192.1"
/db_xref="GI:732548640"
/translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVHSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
FVERSTAYSNCYPYYVPDYATLRSLIASSGNLEFTQESFNWTGVAQDGSSYACRRGSV
NSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
IVSTKRSQQTVIPDIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
QSGKSSIMRSDAHIDECNSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNTCIGSIRNGTYDHDIYR
NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:IRD-A01476743.4"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatt ctatgtctga tttttgctca aaaacttccc
61 ggaagtgaca acagcatggc aacgctgtgc ctgggacacc atgcagtgcc aaacggaaca
121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccat
181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
241 acactgatag atgctctact gggggaccct cattgtgatg acttccaaaa caagaaatgg
301 gacctttttg ttgagcgaag cacagcctac agcaactgtt acccttatta tgtgccagat
361 tatgccaccc ttaggtcact aattgcctca tccggcaacc tggaatttac ccaagaaagc
421 ttcaattgga ctggagttgc tcaagacgga tcaagctatg cctgcagaag gggttctgtt
481 aacagtttct ttagtagatt aaattggttg tataacttga attacaagta tccagaacag
541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
601 ccgggtacgg acaaggacca aaccaaccta tatgtccaag catcagggag agttatagtc
661 tctaccaaaa gaagccaaca aactgtaatc ccggatatcg ggtctagacc ctgggtaagg
721 ggtgtctcca gcataataag catctattgg acgatagtaa aaccgggaga catacttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
1021 gagaagcaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
1141 gcagatctta aaagcactca agcggcaatc aaccaaatca ccgggaaatt aaatagagta
1201 atcaagaaaa cgaacgagaa attccatcaa atcgaaaaag aattttcaga agtagaaggg
1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
1441 ggttgcttca aaatatacca caaatgtgac aacacttgca taggatcaat cagaaatgga
1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaggt
1561 gttcagctaa agtcaggata caaagattgg atactatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgttct gctggggttc attatgtggg cctgccaaaa aggcaacatt
1681 aggtgcaaca tttgcattta a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI530309 A/swine/North Carolina/A01410529/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI510214 A/swine/Illinois/A01475015/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI510211 A/swine/Illinois/A01409994/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI510199 A/swine/Illinois/A01410268/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI510190 A/swine/Illinois/A01411463/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI510173 A/swine/Illinois/A01411461/2014 (A/H0) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI507284 A/swine/Illinois/A01411097/2014 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI505102 A/swine/Iowa/A01409518/2013 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI504864 A/swine/Illinois/A01411096/2013 (A/H0) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI460390 A/swine/Indiana/A01260254/2013 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI545852 A/swine/Iowa/A01476426/2014 (A/H3N2) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI538990 A/swine/Michigan/A01410962/2014 (A/H3N2) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI530299 A/swine/Illinois/A01410453/2014 (A/H3N2) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI530284 A/swine/Illinois/A01475190/2014 (A/H3N2) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI508836 A/swine/Illinois/A01409932/2014 (A/H0) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI460381 A/swine/Indiana/A01260284/2013 (A/H3N2) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI508858 A/swine/Illinois/A01410110/2014 (A/H3N2) segment 4 (HA) 3049.9 0.000000e+00 1684/1701 (99%)
EPI532373 A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI505062 A/swine/Illinois/A01409657/2014 (A/H3N2) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI460387 A/swine/Indiana/A01260252/2013 (A/H3N2) segment 4 (HA) 3048.1 0.000000e+00 1685/1702 (99%)
EPI460372 A/swine/Indiana/A01260276/2013 (A/H3N2) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI542447 A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI534947 A/swine/Iowa/A01501048/2014 (A/H3N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI531097 A/swine/Minnesota/A01493481/2014 (A/H3N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI505039 A/swine/Illinois/A01410018/2013 (A/H0) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI538664 A/swine/Iowa/A01410752/2014 (A/H3N2) segment 4 (HA) 3038.9 0.000000e+00 1682/1701 (98%)
EPI531059 A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI530996 A/swine/Iowa/A01410600/2014 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI398672 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA) 3033.3 0.000000e+00 1680/1699 (98%)
EPI391413 A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA) 3033.3 0.000000e+00 1680/1699 (98%)
EPI391404 A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA) 3033.3 0.000000e+00 1680/1699 (98%)
EPI366030 A/Utah/10/2012 (A/H3N2) segment 4 (HA) 3033.3 0.000000e+00 1680/1699 (98%)
EPI545416 A/swine/North Carolina/A01478000/2014 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI545407 A/swine/Iowa/A01476267/2014 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI542551 A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI538670 A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI532376 A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI509764 A/swine/Indiana/A01260416/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI542524 A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1680/1701 (98%)
EPI533782 A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1680/1701 (98%)
EPI396270 A/Indiana/133/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI394913 A/Indiana/132/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI388332 A/Utah/10/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI388327 A/Indiana/14/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI342603 A/swine/NY/A01104005/2011 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI317003 A/swine/Indiana/A0109091/2010 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1679/1699 (98%)
EPI548259 A/swine/Iowa/A01476428/2014 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI542548 A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1679/1701 (98%)
EPI528431 A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI527870 A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI527113 A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI457163 A/swine/Indiana/9622/2011 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI453427 A/swine/Korea/D79/2011 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI453426 A/swine/Korea/A18/2011 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397905 A/Hawaii/03/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397404 A/Indiana/99/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI383528 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI381873 A/Hawaii/03/2012 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI346493 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI339171 A/Maine/06/2011 (A/H3N2) segment 4 (HA) 3022.2 0.000000e+00 1678/1699 (98%)
EPI545858 A/swine/North Carolina/A01476419/2014 (A/H0) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI545840 A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 4 (HA) 3020.4 0.000000e+00 1680/1702 (98%)
EPI545816 A/swine/North Carolina/A01476354/2014 (A/H3N2) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI545379 A/swine/Iowa/A01476223/2014 (A/H3N2) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI542530 A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3018.5 0.000000e+00 1677/1699 (98%)
EPI395328 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3018.5 0.000000e+00 1677/1699 (98%)
EPI493012 A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA) 3016.7 0.000000e+00 1677/1699 (98%)
EPI492349 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA) 3016.7 0.000000e+00 1677/1699 (98%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3016.7 0.000000e+00 1677/1699 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:07 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI531060 A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI533783 A/swine/North Carolina/A01410800/2014 (A/H3N2) segment 6 (NA) 2568.0 0.000000e+00 1403/1410 (99%)
EPI532377 A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 6 (NA) 2568.0 0.000000e+00 1403/1410 (99%)
EPI545408 A/swine/Iowa/A01476267/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI545380 A/swine/Iowa/A01476223/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI542531 A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI538665 A/swine/Iowa/A01410752/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI534948 A/swine/Iowa/A01501048/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI532374 A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 6 (NA) 2562.4 0.000000e+00 1402/1410 (99%)
EPI530997 A/swine/Iowa/A01410600/2014 (A/H3N2) segment 6 (NA) 2562.4 0.000000e+00 1402/1410 (99%)
EPI542448 A/swine/North Carolina/A01476196/2014 (A/H3N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI545841 A/swine/North Carolina/A01476427/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI542564 A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI542552 A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI542543 A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI538671 A/swine/Oklahoma/A01475757/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI533959 A/swine/Iowa/A01501046/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI395885 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393316 A/Ohio/38/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393310 A/West Virginia/09/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI393305 A/Indiana/18/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI392704 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI392683 A/Indiana/13/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI542549 A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 6 (NA) 2551.3 0.000000e+00 1400/1410 (99%)
EPI548260 A/swine/Iowa/A01476428/2014 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI502642 A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI460388 A/swine/Indiana/A01260252/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI460382 A/swine/Indiana/A01260284/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI460373 A/swine/Indiana/A01260276/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI460367 A/swine/Indiana/A01260261/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446868 A/swine/Ohio/12TOSU411/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI433542 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI433535 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI408203 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI406575 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397623 A/Indiana/150/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397502 A/Indiana/104/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397403 A/Indiana/99/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI396298 A/Maryland/23/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI396207 A/Indiana/149/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI396182 A/Indiana/77/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI394059 A/Indiana/38/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI393518 A/Indiana/65/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI393297 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI393291 A/Indiana/38/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI392752 A/Indiana/16/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:10 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI547388 A/swine/Indiana/13TOSU1991/2013 (A/H0) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542550 A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542544 A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI538919 A/swine/Iowa/A01501685/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI538666 A/swine/Iowa/A01410752/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI534949 A/swine/Iowa/A01501048/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI532375 A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI530998 A/swine/Iowa/A01410600/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI528475 A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI528427 A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI527868 A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI527099 A/swine/Indiana/13TOSU1319/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI527088 A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI526885 A/swine/Indiana/13TOSU1043/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509787 A/swine/Indiana/A01260445/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509784 A/swine/Indiana/A01260443/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509775 A/swine/Indiana/A01260426/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI507295 A/swine/Illinois/A00843193/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI505083 A/swine/Illinois/A01409611/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI505070 A/swine/Illinois/A01411232/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI505038 A/swine/Illinois/A01409717/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI502745 A/swine/Iowa/A01290820/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI502385 A/swine/Illinois/A01427136/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI499890 A/swine/Indiana/A01260398/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI485991 A/swine/Indiana/13TOSU1128/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI485983 A/swine/Indiana/13TOSU1122/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI482815 A/Indiana/21/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI482812 A/Indiana/11/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI476669 A/swine/Michigan/A01259074/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI472212 A/swine/Indiana/A01260313/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI472197 A/swine/Iowa/A01432817/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI468209 A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI468201 A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI465418 A/Indiana/17/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI465389 A/Indiana/09/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI465386 A/Indiana/10/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI465383 A/Indiana/07/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI463710 A/swine/Illinois/A01432795/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI460975 A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI451205 A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI448836 A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI447028 A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443110 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443107 A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443100 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443097 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI441501 A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI427186 A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI426885 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI424076 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414154 A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406528 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406505 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI404893 A/Iowa/16/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI499949 A/swine/Iowa/13H087/2013 (A/H3N2) segment 7 (MP) 1799.8 0.000000e+00 979/982 (99%)
EPI546902 A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI545815 A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI542565 A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI542553 A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI542532 A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI542526 A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI532378 A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI531061 A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI531031 A/swine/Illinois/A01475266/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI528443 A/swine/Ohio/13TOSU2194/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI526923 A/swine/Indiana/13TOSU1155/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509751 A/swine/Iowa/13H068/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509744 A/swine/Iowa/13H081/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509737 A/swine/Iowa/13H075/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509723 A/swine/Iowa/13H082/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI505077 A/swine/Illinois/A01409675/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI501536 A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI499940 A/swine/Iowa/13H069/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI499924 A/swine/Iowa/13H094/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI493014 A/swine/Kansas/A01377090/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI492351 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI485857 A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI472185 A/swine/Iowa/A01432840/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI467959 A/swine/Ohio/A01351573/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI466711 A/Illinois/03/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI465380 A/Indiana/05/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI464501 A/Indiana/04/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI464498 A/Indiana/05/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI463731 A/swine/Iowa/A01432784/2013 (A/H1N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI451230 A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446881 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446873 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446857 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446832 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446824 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI446736 A/swine/Ohio/A01349615/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI414181 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI407274 A/Minnesota/18/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI401715 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI401659 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI401615 A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI398545 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI398537 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397957 A/Ohio/88/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397943 A/Ohio/84/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 5 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Majestic-12 [Bot], Yahoo [Bot] and 55 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group