Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sat Oct 21, 2017 7:12 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 31 posts ]  Go to page 1, 2, 3, 4  Next
Author Message
PostPosted: Tue Dec 09, 2014 11:49 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The OIE report filed today for the high path avian influenza in Fraser Valley failed to give the actual sequence, which almost certainly would be Fujian, which has four additional basic amino acids at the cleavage site The T in low path is replaced by RRRK.

The low path sequences, which were published for the 2009 H5N2 outbreak in Fraser Valley or the 2010 outbreak in Manitoba is

RETR/GLF

In contrast the Fujian cleavage site is
RERRRKR/GLF

The cleavage site is well known and publication in the OIE report would clearly indicate the H5 is Fujian high path, which is why it was withheld.

The failure to include this in the report is an indirect admission that the H5 in Fraser Valley is Fujian clade 2.3.4,

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:01 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2009 low path H5N2 in Fraser Valley

The premises where the disease was diagnosed is in the Fraser Valley in the province of British Columbia, where an important event of highly pathogenic avian influenza also occurred in 2004. British Columbia is located at the westernmost limit of Canada. Birds from this farm were submitted by the veterinary private practitioner to the Animal Health Centre (AHC - British Columbia Ministry of Agriculture, Food and Fisheries) as a routine submission for a respiratory related problem with no significant mortality. The AHC is a member of the Canadian Avian Influenza Laboratory Network. The Canadian Food Inspection Agency (CFIA) National Center for Foreign Animal Diseases confirmed the diagnosis (conventional PCR H5 positive) on samples initially processed by the AHC. Results of gene sequencing indicate a low path cleavage site (NVPQRETR/GLFGAIA). The sequence is 99% related to another H5 virus (H5N2) from California in 2007. Closest match in Genbank is A/American green-winged teal/California/HKWF609/2007(H5N2), accession number: CY033444 Additional tests are underway. The index premises and all premises within 3 km of this premises have been placed under quarantine. Trace out investigations are underway and all significant contacts will also be quarantined. Surveillance and control activities have started in accordance with the CFIA Notifiable Avian Influenza Hazard Specific Plan. Note by the OIE Animal Health Information Department: H5 and H7 avian influenza in its low pathogenic form in poultry is a notifiable disease as per Chapter 10.4. on avian influenza of the Terrestrial Animal Health Code (2008).

http://www.oie.int/wahis_2/public/wahid ... ortid=7720

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:07 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Avian Dis. 2014 Mar;58(1):1-7.
Characterization of a low pathogenic avian influenza H5N2 virus isolated from a turkey breeder flock in Manitoba, Canada.
Berhane Y, Joseph T, Kehler H, Hisanaga T, Embury-Hyatt C, Diederich S, McGreevy KH, Handel K, Cottam-Birt C, Pasick J.
Abstract
In November 2010, an outbreak of avian influenza (AI) due to the H5N2 subtype virus occurred in a turkey breeder farm in northern Manitoba, Canada. The only clinical signs observed were depression, decrease in food consumption, and loss of egg production. The hemagglutinin (HA) cleavage (HA(0)) site of the isolated H5N2 virus was PQRETR/GLF, consistent with low pathogenic AI viruses. The intravenous pathogenicity index of this virus was zero. Whole-genome sequencing of two isolates that originated from two different barns was performed, and both isolates had 100% identical protein sequence in PB2, HA, NP, M1, M2, NS1, and NS2. The remaining gene segments (PB1, PA, and NA) had a single amino-acid difference when compared with each other. The nucleotide and protein sequences of eight gene segments from both isolates showed 99 or greater identity with other AI viruses that have been circulating in free-living aquatic birds in Canada and the United States within the last 10 yr. Phylogenetic analysis of the HA and neuraminidase (NA) gene segments showed that these viruses are closely related to other H5 strains that have been isolated from Manitoba and other parts of Canada. Serologic testing of archived serum samples collected from these turkeys a week before the outbreak showed no evidence of AI infection. In addition, other farms that were located within 3 km radius from the infected farm and farms that had epidemiologic connection with the farm also tested negative for the presence of H5N2 AI virus or antibody. This indicates that the virus might have been introduced to the farm from wild aquatic birds only a short time before detection. Results of this study highlight the importance of early detection and the significance of ongoing Canada-wide surveillance of AI in domestic poultry as well as in wild aquatic birds/ducks.

PMID: 24758106 [PubMed - indexed for MEDLINE]
http://www.ncbi.nlm.nih.gov/pubmed/24758106

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ509148 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ509148
VERSION KJ509148.1 GI:594705058
KEYWORDS .
SOURCE Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8))
ORGANISM Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ509145-KJ509152 represent sequences
from the 8 segments of Influenza A virus (A/tundra
swan/Korea/H411/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/tundra
swan/Korea/H411/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/tundra swan/Korea/H411/2014"
/serotype="H5N8"
/host="tundra swan"
/db_xref="taxon:1470249"
/segment="4"
/country="South Korea"
/collection_date="06-Feb-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24337.1"
/db_xref="GI:594705059"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLVIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatccgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctggtc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc ctacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgctacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:17 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ509164 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8))
segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION KJ509164
VERSION KJ509164.1 GI:594705011
KEYWORDS .
SOURCE Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8))
ORGANISM Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ509161-KJ509168 represent sequences
from the 8 segments of Influenza A virus (A/spot-billed
duck/Korea/H455-42/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/spot-billed
duck/Korea/H455-42/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/spot-billed duck/Korea/H455-42/2014"
/serotype="H5N8"
/host="spot-billed duck"
/db_xref="taxon:1470248"
/segment="4"
/country="South Korea"
/collection_date="08-Feb-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24313.1"
/db_xref="GI:594705012"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECIESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc ctacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatagaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgctacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ511812 1746 bp cRNA linear VRL 30-AUG-2014
DEFINITION Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ511812
VERSION KJ511812.1 GI:629688571
KEYWORDS .
SOURCE Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8))
ORGANISM Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1746)
AUTHORS Ku,K.B., Park,E.H., Yum,J., Kim,J.A., Oh,S.K. and Seo,S.H.
TITLE Highly Pathogenic Avian Influenza A(H5N8) Virus from Waterfowl,
South Korea, 2014
JOURNAL Emerging Infect. Dis. 20 (9), 1587-1588 (2014)
PUBMED 25152954
REFERENCE 2 (bases 1 to 1746)
AUTHORS Ku,K.B., Park,E.H., Yum,J., Kim,J.A., Oh,S.K. and Seo,S.H.
TITLE Direct Submission
JOURNAL Submitted (02-MAR-2014) College of Veterinary Medicine, Laboratory
of Influenza Research, Chungnam National University, 220 Gung Dong,
Yuseong Gu, Daejeon 305-764, South Korea
COMMENT GenBank Accession Numbers KJ511809-KJ511816 represent sequences
from the 8 segments of Influenza A virus
(A/waterfowl/Korea/S005/2014(H5N8)).
FEATURES Location/Qualifiers
source 1..1746
/organism="Influenza A virus
(A/waterfowl/Korea/S005/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/waterfowl/Korea/S005/2014"
/serotype="H5N8"
/host="waterfowl"
/db_xref="taxon:1470486"
/segment="4"
/country="South Korea"
/collection_date="15-Feb-2014"
/note="passage details: embryonated eggs"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHN19570.1"
/db_xref="GI:597717560"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc ctacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacatcct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgctacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 taaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:24 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ508932 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/Baikal teal/Korea/H41/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ508932
VERSION KJ508932.1 GI:594705713
KEYWORDS .
SOURCE Influenza A virus (A/Baikal teal/Korea/H41/2014(H5N8))
ORGANISM Influenza A virus (A/Baikal teal/Korea/H41/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ508929-KJ508936 represent sequences
from the 8 segments of Influenza A virus (A/Baikal
teal/Korea/H41/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/Baikal
teal/Korea/H41/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/Baikal teal/Korea/H41/2014"
/serotype="H5N8"
/host="Baikal teal"
/db_xref="taxon:1470217"
/segment="4"
/country="South Korea"
/collection_date="19-Jan-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24661.1"
/db_xref="GI:594705714"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc atacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgttacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ509044 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/breeder chicken/Korea/H122/2014(H5N8)) segment
4 hemagglutinin (HA) gene, complete cds.
ACCESSION KJ509044
VERSION KJ509044.1 GI:594705377
KEYWORDS .
SOURCE Influenza A virus (A/breeder chicken/Korea/H122/2014(H5N8))
ORGANISM Influenza A virus (A/breeder chicken/Korea/H122/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ509041-KJ509048 represent sequences
from the 8 segments of Influenza A virus (A/breeder
chicken/Korea/H122/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/breeder
chicken/Korea/H122/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/breeder chicken/Korea/H122/2014"
/serotype="H5N8"
/host="breeder chicken"
/db_xref="taxon:1470230"
/segment="4"
/country="South Korea"
/collection_date="24-Jan-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24493.1"
/db_xref="GI:594705378"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc atacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtacggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgttacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:28 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ509076 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ509076
VERSION KJ509076.1 GI:594705280
KEYWORDS .
SOURCE Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8))
ORGANISM Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ509073-KJ509080 represent sequences
from the 8 segments of Influenza A virus (A/breeder
duck/Korea/H158/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/breeder
duck/Korea/H158/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/breeder duck/Korea/H158/2014"
/serotype="H5N8"
/host="breeder duck"
/db_xref="taxon:1470233"
/segment="4"
/country="South Korea"
/collection_date="26-Jan-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24445.1"
/db_xref="GI:594705281"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aatgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc atacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaagag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgttacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 10, 2014 12:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ509140 1742 bp cRNA linear VRL 07-OCT-2014
DEFINITION Influenza A virus (A/bean goose/Korea/H328/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ509140
VERSION KJ509140.1 GI:594705082
KEYWORDS .
SOURCE Influenza A virus (A/bean goose/Korea/H328/2014(H5N8))
ORGANISM Influenza A virus (A/bean goose/Korea/H328/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1742)
AUTHORS Jeong,J., Kang,H.M., Lee,E.K., Song,B.M., Kwon,Y.K., Kim,H.R.,
Choi,K.S., Kim,J.Y., Lee,H.J., Moon,O.K., Jeong,W., Choi,J.,
Baek,J.H., Joo,Y.S., Park,Y.H., Lee,H.S. and Lee,Y.J.
TITLE Highly pathogenic avian influenza virus (H5N8) in domestic poultry
and its relationship with migratory birds in South Korea during
2014
JOURNAL Vet. Microbiol. 173 (3-4), 249-257 (2014)
PUBMED 25192767
REFERENCE 2 (bases 1 to 1742)
AUTHORS Lee,Y.-J., Kang,H.-M., Lee,E.-K., Song,B.-M., Jeong,J., Lee,K.-J.
and Hong,M.-S.
TITLE Direct Submission
JOURNAL Submitted (28-FEB-2014) Avian Disease Division, Animal and Plant
Quarantine Agency (QIA), 175, Anyang-ro, Anyang-city, Gyeonggi-do
430-757, Republic of Korea
COMMENT GenBank Accession Numbers KJ509137-KJ509144 represent sequences
from the 8 segments of Influenza A virus (A/bean
goose/Korea/H328/2014(H5N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1742
/organism="Influenza A virus (A/bean
goose/Korea/H328/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/bean goose/Korea/H328/2014"
/serotype="H5N8"
/host="bean goose"
/db_xref="taxon:1470227"
/segment="4"
/country="South Korea"
/collection_date="01-Feb-2014"
/note="passage details: chicken embryo 1"
gene 15..1718
/gene="HA"
CDS 15..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AHM24349.1"
/db_xref="GI:594705083"
/translation="MEKIVLLLAVVSLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEARLKIEEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1049
/gene="HA"
/product="HA1"
mat_peptide 1050..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ttcaatctgt caaaatggag aaaatagtgc ttcttcttgc agtggttagc cttgttaaaa
61 gtgatcagat ttgcattggt taccatgcaa acaactcaac aaagcaggtt gacacgataa
121 tggaaaaaaa cgtcactgtt acacatgccc aagacatact ggaaaagaca cacaacggga
181 agctctgcga tcttaatgga gtgaagcccc tgattctaaa ggattgtagc gtagctgggt
241 ggctccttgg aaatccaatg tgcgacgagt tcatcagggt gccggaatgg tcttacatcg
301 tggagagggc taacccagcc aacgacctct gttacccagg gaccctcaat gactatgagg
361 aactgaaaca cctattgagc agaataaatc attttgagaa aactctgatc atccccaaga
421 gttcttggcc caatcatgaa acatcattag gggtgagcgc agcatgtcca taccagggag
481 catcctcatt tttcagaaat gtggtatggc tcatcaaaaa gaacgatgca tacccgacaa
541 taaagataag ctacaataat accaatcggg aagatctttt gatactgtgg gggattcatc
601 attccaacaa tgcagcagag cagacaaatc tctataaaaa cccagacact tatgtttccg
661 ttgggacatc aacattaaac cagagattgg tgccaaaaat agctactaga tcccaagtaa
721 acgggcaacg tggaagaatg gatttcttct ggacaatttt aaaaccgaat gatgcaatcc
781 actttgagag taatggaaat ttcattgctc cagaatatgc atacaaaatt gtcaagaaag
841 gggactcaac aattatgaaa agtgaagtgg agtatggcca ctgcaacacc aaatgtcaaa
901 ctccaatagg ggcgataaac tctagcatgc cattccacaa tatacaccct ctcaccatcg
961 gggaatgccc caaatacgtg aagtcaaaca aattagtcct tgcgactggg ctcagaaata
1021 gtcctctaag agaaagaaga agaaaaagag gactatttgg agctatagca gggtttatag
1081 agggaggatg gcagggaatg gtagacggtt ggtatgggta ccaccatagc aatgagcagg
1141 ggagtgggta cgctgcagac aaagaatcca cccaaaaggc aatagatgga gttaccaata
1201 aggtcaactc aatcattgac aaaatgaaca ctcaatttga ggccgttgga agggaattta
1261 ataacttaga aaggagaata gagaatttaa acaagaaaat ggaagacgga ttcctagatg
1321 tctggactta taatgctgaa cttttagttc tcatggaaaa tgagagaact ctagatttcc
1381 atgactcaaa tgtcaagaac ctttacgaca aagtccgact acagcttagg gataatgcaa
1441 aggagctggg taatggttgt ttcgagttct atcacaaatg tgataacgaa tgtatggaaa
1501 gcgtaagaaa tgggacgtat gactacccta agtattcaga agaagcaaga ttaaaaatag
1561 aagaaataag cggagtgaaa ttagaatcaa taggaactta ccaaatactg tcaatttatt
1621 caacagtggc gagttcccta gcactggcaa tcatagtggc tggtctatct ttatggatgt
1681 gctctaatgg gtcgttacaa tgcagaattt gcatctaaat ttgtgagctc agattgtaat
1741 ta

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 31 posts ]  Go to page 1, 2, 3, 4  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 56 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group