Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 9:09 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page Previous  1, 2
Author Message
PostPosted: Mon Dec 08, 2014 10:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS JX570819 1767 bp cRNA linear VRL 20-MAR-2014
DEFINITION Influenza A virus (A/turkey/MB/FAV11/2010(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION JX570819
VERSION JX570819.1 GI:407361242
KEYWORDS .
SOURCE Influenza A virus (A/turkey/MB/FAV11/2010(H5N2))
ORGANISM Influenza A virus (A/turkey/MB/FAV11/2010(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1767)
AUTHORS Berhane,Y., Joseph,T., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Diederich,S., McGreevy,K.H., Handel,K., Cottam-Birt,C. and
Pasick,J.
TITLE Characterization of a low pathogenic avian influenza H5N2 virus
isolated from a turkey breeder flock in Manitoba, Canada
JOURNAL Avian Dis. 58 (1), 1-7 (2014)
PUBMED 24758106
REFERENCE 2 (bases 1 to 1767)
AUTHORS Berhane,Y., Tomy,J., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Hooper-McGreevy,K., Cottam-Birt,C. and Pasick,J.
TITLE Direct Submission
JOURNAL Submitted (04-SEP-2012) National Centre for Foreign Animal Disease,
Canadian Food Inspection Agency, 1015 Arlington St., Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers JX570819-JX570826 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/MB/FAV11/2010(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNAstar LaserGene v. 9
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1767
/organism="Influenza A virus
(A/turkey/MB/FAV11/2010(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/MB/FAV11/2010"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1229838"
/segment="4"
/country="Canada: Manitoba"
/collection_date="25-Nov-2010"
/note="passage details: 1CE-2dpi"
gene 29..1723
/gene="HA"
CDS 29..1723
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFU10231.1"
/db_xref="GI:407361243"
/translation="MERIVIALAIISIVKGDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKEHNGKLCSLKGVRPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDNPV
NGLCYPGDFSDYEELKHLMSSTNHFEKIQIIPRSSWSNHDASSGVSSACPYNGRSSFF
RNVVWLIKKNNAYPTIKRTYNNTNVEDLLIIWGIHHPNDAAEQTKLYQNSNTYVSVGT
STLNQRSIPEIATRPKVNGQSGRMEFFWTILKSNDAISFESNGNFIAPEYAYKIVKKG
DSAIMRSELEYGNCDTNCQTPLGAINSSMPFHNVHPLTIGECPKYVKSDKLVLATGPR
NVPQRETRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITN
KVNSIIDKMNTQFEVVGKEFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEES
RLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMIAGLSFWMCSNGSLQCRICI"
sig_peptide 29..76
/gene="HA"
mat_peptide 77..1054
/gene="HA"
/product="HA1"
mat_peptide 1055..1720
/gene="HA"
/product="HA2"
ORIGIN
1 agcaaaagca ggggtccaaa ctatgaaaat ggaaagaata gtgattgccc tcgcaataat
61 cagcattgtc aaaggtgacc aaatttgcat tggttaccat gcaaacaatt caacagagca
121 ggttgataca atcatggaaa agaatgtgac ggtcacacat gctcaagata tactggaaaa
181 agagcacaat gggaaacttt gcagtcttaa aggagtgagg cccctcatcc tgaaggattg
241 cagtgtagct ggatggcttc ttggaaaccc aatgtgtgat gaattcctga atgtaccaga
301 atggtcatac atcgtggaaa aagataatcc agtcaatggc ctgtgctatc caggagactt
361 cagcgactat gaagaactga agcatttaat gagtagcaca aaccattttg agaaaattca
421 gataatccct aggagttctt ggtccaatca tgacgcctca tcaggagtga gttcggcatg
481 cccatacaat ggtagatctt cctttttcag gaatgtagtg tggttgatca agaagaataa
541 tgcgtaccca acaataaaga ggacctataa caacaccaat gtagaagacc ttttaataat
601 atggggaata caccacccta atgatgcagc tgaacaaaca aaactctacc agaactcgaa
661 cacttatgtg tctgtaggaa catcaacact gaaccagaga tcaatcccag aaatagccac
721 tagacccaaa gtgaacggac aaagtggaag aatggaattt ttctggacaa tactgaagtc
781 gaacgatgca atcagctttg aaagtaatgg gaatttyata gctcctgaat atgcgtacaa
841 aattgtcaag aaaggagatt cagcaatcat gagaagtgaa ttggagtatg gtaactgtga
901 caccaactgt cagactccat tgggtgctat aaattccagt atgcccttcc acaatgttca
961 tcctcttacc attggggagt gccccaagta tgtaaaatcg gacaaactgg tccttgcaac
1021 aggaccaaga aacgtacccc aaagagaaac aagaggccta tttggtgcaa tagcaggatt
1081 catagaagga ggatggcaag gaatggttga cgggtggtac ggataccatc atagcaatga
1141 gcagggaagt ggatatgctg cagacaaaga atccacccag aaagcaatcg atgggatcac
1201 caataaagta aactcaatca ttgacaaaat gaacactcaa ttcgaagtag ttgggaaaga
1261 attcaacaac ctagaaagga gaatagaaaa tttgaataag aaaatggaag atgggttttt
1321 agatgtatgg acttacaatg cagaacttct cgtgctcatg gaaaacgaaa gaactctgga
1381 tttccatgat tcaaatgtca agaacctata cgataaggtc cgactccagc tgagagacaa
1441 tgcaaaagaa ttaggcaatg gatgcttcga attctaccac aaatgtgaca atgaatgcat
1501 ggaaagtgtg agaaatggaa cgtatgacta tccgcaatat tcagaagaat caagactgaa
1561 cagagaggaa atagacggag tcaagttgga atcaatgggc acctaccaga tattatcaat
1621 ctactcaaca gtggcgagtt ccctagcact ggcaatcatg atagctggtc tatctttttg
1681 gatgtgctcc aatggatcat tgcagtgcag aatttgcatc tagaattgtg agttcagatt
1741 ataattaaaa acacccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page Previous  1, 2

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 41 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group