Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 7:29 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Sat Sep 06, 2014 10:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The USDA has released three sets (H3, N1, MP) of sequences from H3N1v swine including 2014 sequences from Missouri and an unknown lication in the US. Similar sequences are also in a July 2013 sequence, also from an undisclosed location in the US.

All three sets have an H3 related to seasonal H3N2 from the 2010/2011 season, an N1 related to H1N1v sequences including the 2007 outbreak in Huron, Ohio, and an MP gene from H1N1pdm09.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ941380 1701 bp cRNA linear VRL 05-SEP-2014
DEFINITION Influenza A virus (A/swine/Missouri/A01410819/2014(H3N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ941380
VERSION KJ941380.1 GI:662495796
KEYWORDS .
SOURCE Influenza A virus (A/swine/Missouri/A01410819/2014(H3N1))
ORGANISM Influenza A virus (A/swine/Missouri/A01410819/2014(H3N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Deike,P.H. and Zhang,J.
CONSRTM USDA Swine Influenza Surveillance
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2014) USDA SIV Surveillance, National Veterinary
Services Labortary, 1920 Dayton, Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Missouri/A01410819/2014(H3N1))"
/mol_type="viral cRNA"
/strain="A/swine/Missouri/A01410819/2014"
/serotype="H3N1"
/isolation_source="nasal swab"
/host="swine"
/db_xref="taxon:1507020"
/segment="4"
/country="USA: Missouri"
/collection_date="15-Jan-2014"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIE52194.1"
/db_xref="GI:662495797"
/translation="MKTIIALSYILCLVFAQKLPGNDNNMATLCLGHHAVPNGTIVKT
ITNDQIEVTNATELVQSSSAGEICNSPHQILDGENCTLIDALLGDPQCDGFQNKNWDL
FVERSKAHSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGASSACKRRSN
KSFFSRLNWLTHLNSKYPALEVTMPNNEQFDKLYIWGVHHPATDKDQISLYAQAAGRI
IVSTKRSQQAVIPNIGSRPRVRDIPSRVSIYWTIVRPGDILLINSTGNLIAPRGYFKI
RSGKSSIMRSDAPIGKCNSACITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNIPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQ
INGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEALNNRFQIKGVELKSEYKDWILWISFAISCFLLCVALLGFIMWACQKGNIKCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 85..1698
/gene="HA"
/note="Haemagglutinin; Region: Hemagglutinin; pfam00509"
/db_xref="CDD:249917"
misc_feature 1..1701
/db_xref="IRD:IRD-A01410819.4"
ORIGIN
1 atgaagacta tcattgcttt gagctacatt ctatgtctgg ttttcgctca aaaacttcct
61 ggtaatgaca acaacatggc aacgctgtgc cttggacacc atgcagtgcc aaacggaacg
121 atagtgaaaa caatcacgaa tgaccaaatt gaagttacta atgctactga gctggttcag
181 agttcctctg caggtgaaat atgcaacagt cctcatcaga tccttgatgg agaaaactgc
241 acactaatag atgctctatt gggagatcct cagtgtgatg gcttccaaaa caagaactgg
301 gacctttttg ttgaacgaag caaagcccac agcaactgtt acccttatga tgtgccggat
361 tatgcctccc ttaggtcact agttgcctca tccggtacac tggagtttaa caatgaaagc
421 ttcaattgga ctggagtaac tcaaaacgga gcaagctctg cttgcaaaag gagatccaac
481 aaaagtttct ttagtagatt gaattggttg actcacttaa actccaaata cccagcattg
541 gaagtgacta tgccaaacaa tgaacaattt gacaaattgt acatttgggg ggttcaccac
601 ccggctacgg acaaggacca aatctccctg tatgctcaag cagcaggaag aatcatagta
661 tctaccaaaa gaagccaaca agctgtaatt ccgaatatcg ggtctagacc cagagtaagg
721 gatatcccta gcagagtaag catctattgg acgatagtaa gaccgggaga catacttttg
781 attaacagca cagggaatct aattgctcct aggggttact tcaaaatacg aagtgggaaa
841 agctcaataa tgagatcaga tgcacccatt ggcaaatgca attctgcatg catcactcca
901 aatggaagca ttcccaatga caaaccattc caaaatgtaa acaggatcac atacggggcc
961 tgtcccagat atgttaagca aaacactctg aaattggcaa caggaatgag aaatatacca
1021 gagaaacaaa ctagaggcat atttggcgca atagctggtt tcatagaaaa tggttgggag
1081 ggaatggtgg atggttggta cggtttcagg catcaaaatt ctgagggaag gggacaagca
1141 gcagatctca aaagcactca agcagcaatc gatcaaatca atgggaagct gaatagattg
1201 atcgggaaaa ccaacgagaa attccatcag attgaaaaag aattttcaga agtcgaaggg
1261 agaattcagg accttgagaa atatgttgag gacactaaaa tagatctctg gtcatacaac
1321 gcggagcttc ttgttgccct ggagaaccaa cacacaattg atctaactga ctcagaaatg
1381 aacaaattgt ttgaaaaaac aaagaagcaa ctgagggaaa atgctgagga tatgggcaat
1441 ggttgtttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaacgga
1501 acttatgacc acgatgtgta cagagatgaa gcattaaaca accgattcca gatcaaggga
1561 gttgagctga agtcagagta caaagattgg attctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgcttt gttggggttc atcatgtggg cctgccaaaa aggcaacatt
1681 aagtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI302243 A/South Dakota/02/2010 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1670/1702 (98%)
EPI301766 A/South Dakota/02/2010 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1670/1702 (98%)
EPI316181 A/Rhode Island/04/2011 (A/H3N2) segment 4 (HA) 2961.3 0.000000e+00 1669/1702 (98%)
EPI511992 A/Tennessee/F2011/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI511939 A/Tennessee/F2019A/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI497462 A/Peru/PER373/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI408585 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI408580 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI366356 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI359476 A/Boston/DOA75/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI335948 A/Santiago/18454/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI335923 A/Iowa/19/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI335861 A/Argentina/676/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI325969 A/Mexico City/WRAIR3579T/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI319740 A/Minnesota/09/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI319656 A/California/22/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI319128 A/Illinois/NHRC0002/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI316114 A/Mississippi/03/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI316040 A/District of Columbia/03/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI309616 A/Texas/05/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI309493 A/Maryland/07/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI309464 A/Wyoming/04/2011 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI302319 A/Iowa/12/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI302304 A/Iowa/11/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI301737 A/Arkansas/03/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI301125 A/Nebraska/03/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI301121 A/Arkansas/05/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI301101 A/Texas/12/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI295227 A/Mexico/4674/2010 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI316028 A/Delaware/03/2011 (A/H3N2) segment 4 (HA) 2957.6 0.000000e+00 1668/1702 (98%)
EPI316236 A/Washington/06/2011 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI309581 A/Georgia/01/2011 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI309563 A/Delaware/02/2011 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI309387 A/Mexico/6605/2010 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI309362 A/Illinois/01/2010 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI302327 A/Iowa/19/2010 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI511925 A/Tennessee/F2018A/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI511918 A/Tennessee/F2018/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI511802 A/Tennessee/F2059/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI496831 A/Peru/PER285/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI496382 A/Peru/PER220/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI495328 A/Peru/PER160/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI495076 A/Peru/PER123/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI427107 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI426917 A/Florida/11/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI361046 A/Boston/DOA15/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI359468 A/Boston/DOA86/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342333 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342330 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342303 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342300 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342297 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342205 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342203 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342197 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI342195 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI335946 A/Santiago/14944/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI335943 A/Santiago/13652/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI334570 A/Mexico City/WRAIR3569N/2010(H3N2) (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI326278 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325961 A/Mexico City/WRAIR3579N/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325937 A/Mexico City/WRAIR3577T/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325929 A/Mexico City/WRAIR3571N/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325905 A/Mexico City/WRAIR3569T/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325889 A/Mexico City/WRAIR3568N/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI325881 A/Mexico City/WRAIR3568N/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI320357 A/California/NHRC0004/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI320349 A/California/NHRC0003/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI320341 A/California/NHRC0002/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI319650 A/Arizona/03/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI319248 A/Ireland/11M27357/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI316239 A/Wisconsin/09/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI316209 A/Vermont/03/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI316200 A/Texas/06/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI316013 A/Alabama/01/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309455 A/Colorado/01/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309431 A/Texas/26/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309412 A/California/03/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1669/1703 (98%)
EPI309405 A/Costa Rica/0096/2001 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309394 A/Nebraska/02/2011 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309373 A/Texas/23/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI301759 A/Oklahoma/02/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI301111 A/California/27/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI301047 A/Georgia/19/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI301027 A/Colorado/05/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI301018 A/Florida/27/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI295199 A/Belize/3715/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI295193 A/Texas/07/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI291556 A/Costa Rica/6696/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI287082 A/Panama/307149/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI279988 A/Mexico/4056/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI279979 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI279967 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI279961 A/Florida/11/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI278766 A/Dominican Republic/4319/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI278760 A/Panama/307149/2010 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI309557 A/Vermont/03/2011 (A/H3N2) segment 4 (HA) 2952.1 0.000000e+00 1667/1702 (97%)
EPI316082 A/Kansas/03/2011 (A/H3N2) segment 4 (HA) 2950.2 0.000000e+00 1667/1702 (97%)
EPI302295 A/Delaware/06/2010 (A/H3N2) segment 4 (HA) 2950.2 0.000000e+00 1667/1702 (97%)
EPI295154 A/Florida/18/2010 (A/H3N2) segment 4 (HA) 2950.2 0.000000e+00 1667/1702 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:38 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI406548 A/swine/Illinois/A01203922/2012 (A/H1N1) segment 6 (NA) 2507.0 0.000000e+00 1393/1411 (98%)
EPI509533 A/swine/Iowa/A01410129/2014 (A/H1N1) segment 6 (NA) 2453.5 0.000000e+00 1383/1411 (98%)
EPI384558 A/swine/Illinois/A01047924/2011 (A/H1N1) segment 6 (NA) 2446.1 0.000000e+00 1381/1410 (97%)
EPI368328 A/swine/Illinois/A01047930/2011 (A/H1N1) segment 6 (NA) 2435.0 0.000000e+00 1379/1410 (97%)
EPI384609 A/swine/Oklahoma/A01134903/2011 (A/H1N1) segment 6 (NA) 2423.9 0.000000e+00 1377/1410 (97%)
EPI371693 A/swine/Oklahoma/A01134908/2011 (A/H1N1) segment 6 (NA) 2423.9 0.000000e+00 1377/1410 (97%)
EPI368354 A/swine/Oklahoma/A01134906/2011 (A/H1N1) segment 6 (NA) 2423.9 0.000000e+00 1377/1410 (97%)
EPI390806 A/swine/Oklahoma/A01134901/2011 (A/H1N1) segment 6 (NA) 2418.4 0.000000e+00 1374/1407 (97%)
EPI384257 A/swine/Illinois/A01076767/2010 (A/H1N1) segment 6 (NA) 2403.6 0.000000e+00 1368/1402 (97%)
EPI491930 A/swine/Texas/SG1162/2003 (A/H1N1) segment 6 (NA) 2207.9 0.000000e+00 1342/1414 (94%)
EPI491598 A/swine/Texas/SG1162/2003 (A/H1N1) segment 6 (NA) 2207.9 0.000000e+00 1342/1414 (94%)
EPI492127 A/swine/Texas/SG1187/2004 (A/H1N1) segment 6 (NA) 2169.1 0.000000e+00 1334/1413 (94%)
EPI491954 A/swine/Texas/SG1187/2004 (A/H1N1) segment 6 (NA) 2169.1 0.000000e+00 1334/1413 (94%)
EPI490327 A/swine/Texas/00244/2004 (A/H1N1) segment 6 (NA) 2169.1 0.000000e+00 1335/1414 (94%)
EPI492217 A/swine/Texas/00525/2005 (A/H1N1) segment 6 (NA) 2163.5 0.000000e+00 1333/1413 (94%)
EPI488587 A/swine/Oklahoma/SG1243/2006 (A/H1N1) segment 6 (NA) 2158.0 0.000000e+00 1334/1415 (94%)
EPI490432 A/swine/Texas/00867/2005 (A/H1N1) segment 6 (NA) 2152.5 0.000000e+00 1331/1413 (94%)
EPI488692 A/swine/Texas/01822/2007 (A/H3N1) segment 6 (NA) 2108.1 0.000000e+00 1324/1414 (93%)
EPI488685 A/swine/Texas/SG1271/2007 (A/H1N1) segment 6 (NA) 2097.1 0.000000e+00 1322/1414 (93%)
EPI482807 A/Wisconsin/10/1998 (A/H1N1) segment 6 (NA) 2097.1 0.000000e+00 1322/1414 (93%)
EPI392830 A/swine/Mexico/Ver37/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI392822 A/swine/Mexico/Ver31/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI392815 A/swine/Mexico/Ver29/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI392808 A/swine/Mexico/Qro35/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI392800 A/swine/Mexico/Qro32/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI392760 A/swine/Mexico/Mex19/2010 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1323/1416 (93%)
EPI8419 A/Wisconsin/10/98 (A/H1N1) segment 6 (NA) 2091.5 0.000000e+00 1321/1414 (93%)
EPI392784 A/swine/Mexico/Mex52/2010 (A/H1N1) segment 6 (NA) 2087.8 0.000000e+00 1322/1416 (93%)
EPI491606 A/swine/Texas/00195/2003 (A/H1N1) segment 6 (NA) 2036.1 0.000000e+00 1311/1414 (92%)
EPI491718 A/swine/Oklahoma/SG1188/2004 (A/H1N1) segment 6 (NA) 2025.0 0.000000e+00 1309/1414 (92%)
EPI490453 A/swine/Oklahoma/00801/2005 (A/H1N1) segment 6 (NA) 2025.0 0.000000e+00 1312/1417 (92%)
EPI165699 A/swine/Memphis/1/1990 (A/H1N1) segment 6 (NA) 2019.5 0.000000e+00 1310/1416 (92%)
EPI77678 A/swine/California/T9001707/1991 (A/H1N1) segment 6 (NA) 2014.0 0.000000e+00 1309/1416 (92%)
EPI490663 A/swine/Oklahoma/00743/2005 (A/H1N1) segment 6 (NA) 2002.9 0.000000e+00 1308/1417 (92%)
EPI335019 A/swine/North Carolina/18161/2002 (A/H1N1) segment 6 (NA) 1997.3 0.000000e+00 1303/1413 (92%)
EPI240275 A/turkey/NC/19762/1988 (A/H1N1) segment 6 (NA) 1997.3 0.000000e+00 1306/1416 (92%)
EPI491622 A/swine/Kentucky/SG1167/2003 (A/H1N1) segment 6 (NA) 1986.3 0.000000e+00 1304/1416 (92%)
EPI337491 A/swine/Illinois/SG1141/2003 (A/H1N1) segment 6 (NA) 1986.3 0.000000e+00 1302/1414 (92%)
EPI153507 A/swine/Ohio/75004/04 (A/H1N1) segment 6 (NA) 1986.3 0.000000e+00 1301/1413 (92%)
EPI165953 A/turkey/NC/17026/1988 (A/H1N1) segment 6 (NA) 1982.6 0.000000e+00 1304/1416 (92%)
EPI178962 A/swine/Wisconsin/1915/1988 (A/H1N1) segment 6 (NA) 1980.7 0.000000e+00 1303/1416 (92%)
EPI62753 A/swine/Wisconsin/1915/1988 (A/H1N1) segment 6 (NA) 1980.7 0.000000e+00 1303/1416 (92%)
EPI62526 A/swine/Iowa/17672/1988 (A/H1N1) segment 6 (NA) 1980.7 0.000000e+00 1304/1417 (92%)
EPI178970 A/Swine/Indiana/1726/1988 (A/H1N1) segment 6 (NA) 1969.6 0.000000e+00 1301/1416 (91%)
EPI63960 A/swine/Iowa/31483/1988 (A/H1N1) segment 6 (NA) 1969.6 0.000000e+00 1302/1417 (91%)
EPI68596 A/Ohio/3559/1988 (A/H1N1 seasonal) segment 6 (NA) 1964.1 0.000000e+00 1298/1413 (91%)
EPI239972 A/Swine/Indiana/1726/1988 (A/H1N1) segment 6 (NA) 1958.6 0.000000e+00 1299/1416 (91%)
EPI180170 A/swine/North Carolina/9647/2003 (A/H1N1) segment 6 (NA) 1958.6 0.000000e+00 1300/1417 (91%)
EPI492148 A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 6 (NA) 1953.0 0.000000e+00 1298/1416 (91%)
EPI492067 A/swine/North Carolina/SG1168/2003 (A/H1N1) segment 6 (NA) 1953.0 0.000000e+00 1298/1416 (91%)
EPI491649 A/swine/North Carolina/SG1170/2003 (A/H1N1) segment 6 (NA) 1953.0 0.000000e+00 1298/1416 (91%)
EPI492144 A/swine/North Carolina/00237/2004 (A/H1N1) segment 6 (NA) 1947.5 0.000000e+00 1297/1416 (91%)
EPI492088 A/swine/North Carolina/SG1175/2003 (A/H1N1) segment 6 (NA) 1947.5 0.000000e+00 1297/1416 (91%)
EPI491962 A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 6 (NA) 1947.5 0.000000e+00 1297/1416 (91%)
EPI491799 A/swine/Minnesota/SG1235/2005 (A/H1N1) segment 6 (NA) 1941.9 0.000000e+00 1292/1412 (91%)
EPI180184 A/swine/North Carolina/26292/2003 (A/H1N1) segment 6 (NA) 1941.9 0.000000e+00 1297/1417 (91%)
EPI62865 A/swine/Maryland/23239/1991 (A/H1N1) segment 6 (NA) 1941.9 0.000000e+00 1296/1416 (91%)
EPI180178 A/swine/North Carolina/901/2003 (A/H1N1) segment 6 (NA) 1938.3 0.000000e+00 1295/1416 (91%)
EPI180189 A/swine/North Carolina/42577/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1295/1416 (91%)
EPI180187 A/swine/North Carolina/38767/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI180182 A/swine/North Carolina/12869/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI180176 A/swine/North Carolina/46130/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI180172 A/swine/North Carolina/28126/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1294/1414 (91%)
EPI180162 A/swine/North Carolina/44012/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI180160 A/swine/North Carolina/43951/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI180156 A/swine/North Carolina/7571/2003 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1295/1416 (91%)
EPI180190 A/swine/North Carolina/43110/2003 (A/H1N1) segment 6 (NA) 1930.9 0.000000e+00 1294/1416 (91%)
EPI180185 A/swine/North Carolina/35002/2003 (A/H1N1) segment 6 (NA) 1930.9 0.000000e+00 1295/1417 (91%)
EPI180180 A/swine/North Carolina/34562/2003 (A/H1N1) segment 6 (NA) 1930.9 0.000000e+00 1294/1416 (91%)
EPI180158 A/swine/North Carolina/43110/2003 (A/H1N1) segment 6 (NA) 1930.9 0.000000e+00 1294/1416 (91%)
EPI130943 A/WI/4754/1994 (A/H1N1 seasonal) segment 6 (NA) 1930.9 0.000000e+00 1296/1418 (91%)
EPI98716 A/swine/MI/PU243/04 (A/H3N1) segment 6 (NA) 1930.9 0.000000e+00 1294/1416 (91%)
EPI383485 A/swine/Hubei/02/2008 (A/H1N1) segment 6 (NA) 1925.3 0.000000e+00 1293/1416 (91%)
EPI180168 A/swine/North Carolina/47437/2003 (A/H1N1) segment 6 (NA) 1925.3 0.000000e+00 1293/1416 (91%)
EPI178954 A/Maryland/12/1991 (A/H1N1 seasonal) segment 6 (NA) 1925.3 0.000000e+00 1293/1416 (91%)
EPI73839 A/swine/Iowa/24297/1991 (A/H1N1) segment 6 (NA) 1925.3 0.000000e+00 1294/1417 (91%)
EPI68796 A/swine/Kansas/3024/1987 (A/H1N1) segment 6 (NA) 1925.3 0.000000e+00 1294/1417 (91%)
EPI124056 A/swine/North Carolina/36883/2002 (A/H1N1) segment 6 (NA) 1923.5 0.000000e+00 1294/1417 (91%)
EPI490651 A/swine/North Carolina/00396/2004 (A/H1N1) segment 6 (NA) 1919.8 0.000000e+00 1293/1417 (91%)
EPI180174 A/swine/North Carolina/43904/2003 (A/H1N1) segment 6 (NA) 1919.8 0.000000e+00 1292/1415 (91%)
EPI180166 A/swine/North Carolina/46858/2003 (A/H1N1) segment 6 (NA) 1919.8 0.000000e+00 1294/1418 (91%)
EPI180154 A/swine/North Carolina/7386/2004 (A/H1N1) segment 6 (NA) 1919.8 0.000000e+00 1292/1416 (91%)
EPI62847 A/swine/Kansas/3228/1987 (A/H1N1) segment 6 (NA) 1916.1 0.000000e+00 1293/1418 (91%)
EPI491978 A/swine/Minnesota/00574/2005 (A/H1N1) segment 6 (NA) 1914.2 0.000000e+00 1293/1418 (91%)
EPI491791 A/swine/Minnesota/00574/2005 (A/H1N1) segment 6 (NA) 1914.2 0.000000e+00 1293/1418 (91%)
EPI490467 A/swine/North Carolina/SG1477/2005 (A/H1N1) segment 6 (NA) 1914.2 0.000000e+00 1291/1416 (91%)
EPI158920 A/turkey/IA/10271-3/1990 (A/H1N1) segment 6 (NA) 1914.2 0.000000e+00 1293/1418 (91%)
EPI490667 A/swine/North Carolina/SG1229/2005 (A/H1N1) segment 6 (NA) 1908.7 0.000000e+00 1290/1416 (91%)
EPI476457 A/swine/Beijing/156/1991 (A/H1N1) segment 6 (NA) 1908.7 0.000000e+00 1291/1417 (91%)
EPI158912 A/turkey/IA/21089-3/1992 (A/H1N1) segment 6 (NA) 1908.7 0.000000e+00 1290/1416 (91%)
EPI124052 A/swine/Minnesota/37866/1999 (A/H1N1) segment 6 (NA) 1908.7 0.000000e+00 1291/1417 (91%)
EPI491775 A/swine/North Carolina/SG1226/2005 (A/H1N1) segment 6 (NA) 1903.2 0.000000e+00 1289/1416 (91%)
EPI490488 A/swine/North Carolina/00925/2005 (A/H1N1) segment 6 (NA) 1903.2 0.000000e+00 1290/1417 (91%)
EPI490474 A/swine/North Carolina/SG1478/2005 (A/H1N1) segment 6 (NA) 1903.2 0.000000e+00 1288/1415 (91%)
EPI490138 A/swine/Georgia/SG1251/2006 (A/H1N1) segment 6 (NA) 1903.2 0.000000e+00 1290/1417 (91%)
EPI490481 A/swine/North Carolina/SG1479/2005 (A/H1N1) segment 6 (NA) 1897.6 0.000000e+00 1289/1417 (90%)
EPI476458 A/swine/Beijing/216/1992 (A/H1N1) segment 6 (NA) 1897.6 0.000000e+00 1289/1417 (90%)
EPI153508 A/swine/Ohio/C62006/06 (A/H1N1) segment 6 (NA) 1897.6 0.000000e+00 1289/1417 (90%)
EPI490537 A/swine/North Carolina/01591/2007 (A/H1N1) segment 6 (NA) 1892.1 0.000000e+00 1288/1417 (90%)
EPI490558 A/swine/North Carolina/01514/2007 (A/H1N1) segment 6 (NA) 1886.5 0.000000e+00 1287/1417 (90%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:40 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI406547 A/swine/Illinois/A01203922/2012 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI405570 A/Viet Nam/13032076/2009 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI384276 A/swine/Illinois/A01076954/2010 (A/H1N2) segment 7 (MP) 1742.5 0.000000e+00 967/979 (98%)
EPI338513 A/swine/Indiana/A01049964/2011 (A/H1N2) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI332028 A/District of Columbia/INS527/2010 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI324826 A/swine/Iowa/A01049239/2010 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI308288 A/Cape May/WRAIR1653P/2009 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI308176 A/New Jersey/WRAIR1504P/2009 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI308136 A/New Jersey/WRAIR1499P/2009 (A/H1N1) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI257933 A/Hubei-Maojian/SWL197/2010 (A/H1N1 pdm09) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI240323 A/Florida/31/2009 (A/H1N1 pdm09) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI272580 A/KUMAMOTO/20/2010 (A/H1N1 pdm09) segment 7 (MP) 1738.8 0.000000e+00 968/982 (98%)
EPI537971 A/North Dakota/20/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI509534 A/swine/Iowa/A01410129/2014 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI476500 A/swine/Iowa/A01432991/2013 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI471745 A/swine/Thailand/LB160/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI471737 A/swine/Thailand/LB159/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI471721 A/swine/Thailand/LB158/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI471697 A/swine/Thailand/LB164/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI457519 A/swine/Kansas/13-108011/2013 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405733 A/Viet Nam/001-1889/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405717 A/Viet Nam/001-1716/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405709 A/Viet Nam/001-1424/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405677 A/Viet Nam/11032017/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405653 A/Viet Nam/11032006/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405645 A/Viet Nam/11032001/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405562 A/Viet Nam/13032074/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405554 A/Viet Nam/13032071/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405540 A/Viet Nam/13032060/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405524 A/Viet Nam/13032051/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405508 A/Viet Nam/13032044/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405500 A/Viet Nam/13032040/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405476 A/Viet Nam/13032035/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405453 A/Viet Nam/13032016/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405437 A/Viet Nam/13032011/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405429 A/Viet Nam/13032009/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405421 A/Viet Nam/13032008/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405405 A/Viet Nam/13032001/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI405320 A/Viet Nam/001-1890/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI404197 A/Viet Nam/15032002/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI399552 A/swine/Minnesota/A01300999/2012 (A/H3N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI399490 A/swine/Minnesota/A01301000/2012 (A/H3N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI398128 A/swine/Iowa/A01203809/2012 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI392378 A/Scotland/Paisley_413960/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI392371 A/Scotland/Paisley_412182/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI391458 A/swine/Iowa/A01203126/2012 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI391457 A/swine/Iowa/A01203125/2012 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI391335 A/swine/Iowa/A01202727/2011 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI390968 A/swine/Iowa/A01049451/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI384357 A/swine/USA/A01076112/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 966/979 (98%)
EPI384350 A/swine/USA/A01076111/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 966/979 (98%)
EPI384295 A/swine/Illinois/A01047079/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 966/979 (98%)
EPI384289 A/swine/Illinois/A01047048/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 966/979 (98%)
EPI380533 A/Singapore/ON2269/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI379291 A/Singapore/GP4218/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI379261 A/Singapore/GP4000/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI379104 A/Singapore/GP3093/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI378872 A/Singapore/GP2224/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI376273 A/Scotland/Paisley_425827/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI374144 A/Malaysia/2156796/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI371675 A/swine/Oklahoma/A01134908/2011 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI371669 A/swine/Minnesota/A01134333/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI371668 A/swine/Minnesota/A01134332/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI369074 A/swine/Minnesota/A01047604/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI367707 A/swine/Minnesota/A01240127/2011 (A/H3N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI367246 A/Dundgobi/0381/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI353670 A/swine/Mississippi/A01049443/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI351209 A/Hubei/99/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI351127 A/Zhejiang/87/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI351100 A/Zhejiang/84/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI347008 A/Hawaii/34/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI341735 A/swine/Iowa/A01049980/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI341734 A/swine/Illinois/A01049981/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI341733 A/swine/Iowa/A01202023/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI341725 A/swine/Iowa/A01202063/2011 (A/H0N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338524 A/swine/Iillinois/A01049871/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338523 A/swine/Iillinois/A01049872/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338521 A/swine/Iowa/A01049894/2011 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338484 A/swine/Iowa/A01049640/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338476 A/swine/Iowa/A01049718/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338473 A/swine/Iowa/A01049723/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338471 A/swine/Iowa/A01049726/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338470 A/swine/Iowa/A01049728/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI338466 A/swine/Iowa/A01049858/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI332905 A/Pune/NIV0953725/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI330978 A/New Mexico/07/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI324839 A/swine/Iowa/A01049450/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI324447 A/Illinois/NHRC0001/2011 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI320221 A/Bretagne/7639/2009 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI320088 A/New Mexico/06/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI320080 A/New Mexico/05/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI320072 A/New Mexico/04/2011 (A/H1N1 pdm09) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI316959 A/swine/Iowa/A01049037/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI315847 A/swine/South Dakota/6/2011 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI312700 A/swine/Minnesota/239106/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI312684 A/swine/Minnesota/226128/2010 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI308721 A/Berlin/INS362/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI308496 A/Budapest/WRAIR2393T/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI308184 A/New Jersey/WRAIR1506P/2009 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI307831 A/swine/South Dakota/4/2010 (A/H1N2) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:54 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ941383 1701 bp cRNA linear VRL 05-SEP-2014
DEFINITION Influenza A virus (A/swine/USA/2013028053/2013(H3N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ941383
VERSION KJ941383.1 GI:660301559
KEYWORDS .
SOURCE Influenza A virus (A/swine/USA/2013028053/2013(H3N1))
ORGANISM Influenza A virus (A/swine/USA/2013028053/2013(H3N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Deike,P.H., Zhang,J. and Phillip,G.C.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2014) Veterinary Diagnostic and Production Animal
Medicine, Iowa State University, 1600 South 16th Street, Ames, IA
50011, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/USA/2013028053/2013(H3N1))"
/mol_type="viral cRNA"
/strain="A/swine/USA/2013028053/2013"
/serotype="H3N1"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1506990"
/segment="4"
/country="USA"
/collection_date="23-Jul-2013"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AID70330.1"
/db_xref="GI:660301560"
/translation="MKTIIALSYILCLVFAQKLPGNDNNMATLCLGHHAVPNGTIVKT
ITNDQIEVTNATELVQSSSTGEICNSPHQILDGENCTLIDALLGDPQCDGFQNKKWDL
FVERSKAHSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGASSACKRRSN
KSFFSRLNWLTHLNFKYPALEVTMPNNEQFDKLYIWGVHHPATDKDQISLYAQAAGRI
IVSTKRSQQAVIPNIGSRPRVRDIPSRVSIYWTIVRPGDILLINSTGNLIAPRGYFKI
RSGKSSIMRSDAPIGKCNSACITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNIPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQ
INGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEALNNRFQIKGVELKSEYKDWILWISFAISCFLLCVALLGFIMWACQKGNIKCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 85..1698
/gene="HA"
/note="Haemagglutinin; Region: Hemagglutinin; pfam00509"
/db_xref="CDD:249917"
misc_feature 1..1701
/db_xref="IRD:IRD-2013028053.4"
ORIGIN
1 atgaagacta tcattgcttt gagctacatt ctatgtctgg ttttcgctca aaaacttcct
61 ggtaatgaca acaacatggc aacgctgtgc cttggacacc atgcagtgcc aaacggaacg
121 atagtgaaaa caatcacgaa tgaccaaatt gaagttacta atgctactga gctggttcag
181 agttcctcta caggtgaaat atgcaacagt cctcatcaga tccttgatgg agaaaactgc
241 acactaatag atgctctatt gggagatcct cagtgtgatg gcttccaaaa caagaaatgg
301 gacctttttg ttgaacgaag caaagcccac agcaactgtt acccttatga tgtgccggat
361 tatgcctccc ttaggtcact agttgcctca tccggtacac tggagtttaa caatgaaagc
421 ttcaattgga ctggagtaac tcaaaacgga gcaagctctg cttgcaaaag gagatccaac
481 aaaagtttct ttagtagatt gaattggttg actcacttaa acttcaaata cccagcattg
541 gaagtgacta tgccaaacaa tgaacaattt gacaaattgt acatttgggg ggttcaccac
601 ccggctacgg acaaggacca aatctccctg tatgctcaag cagcaggaag aatcatagta
661 tctaccaaaa gaagccaaca agctgtaatt ccgaatatcg ggtctagacc cagagtaagg
721 gatatcccta gcagagtaag catctattgg acaatagtaa gaccgggaga catacttttg
781 attaacagca cagggaatct aattgctcct aggggttact tcaaaatacg aagtgggaaa
841 agctcaataa tgagatcaga tgcacccatt ggcaaatgca attctgcatg catcactcca
901 aatggaagca ttcccaatga caaaccattc caaaatgtaa acaggatcac atacggggcc
961 tgtcccagat atgttaagca aaacactctg aaattggcaa caggaatgag aaatatacca
1021 gagaaacaaa ctagaggcat atttggcgca atagctggtt tcatagaaaa tggttgggag
1081 ggaatggtgg atggttggta cggtttcagg catcaaaatt ctgagggaag gggacaagca
1141 gcagatctca aaagcactca agcagcaatc gatcaaatca atgggaagct gaatagattg
1201 atcgggaaaa ccaacgagaa attccatcag attgaaaaag aattctcaga agtcgaaggg
1261 agaattcagg accttgagaa atatgttgag gacactaaaa tagatctctg gtcatacaac
1321 gcggagcttc ttgttgccct ggagaaccaa cacacaattg atctaactga ctcagaaatg
1381 aacaaattgt ttgaaaaaac aaagaagcaa ctgagggaaa atgctgagga tatgggcaat
1441 ggttgtttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaacgga
1501 acttatgacc acgatgtgta cagagatgaa gcattaaaca accgattcca gatcaaggga
1561 gttgagctga agtcagagta caaagattgg attctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgcttt gttggggttc atcatgtggg cctgccaaaa aggcaacatt
1681 aagtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:57 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI302243 A/South Dakota/02/2010 (A/H3N2) segment 4 (HA) 2992.7 0.000000e+00 1675/1702 (98%)
EPI301766 A/South Dakota/02/2010 (A/H3N2) segment 4 (HA) 2992.7 0.000000e+00 1675/1702 (98%)
EPI316181 A/Rhode Island/04/2011 (A/H3N2) segment 4 (HA) 2989.0 0.000000e+00 1674/1702 (98%)
EPI511992 A/Tennessee/F2011/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI511939 A/Tennessee/F2019A/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI497462 A/Peru/PER373/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI408585 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI408580 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI366356 A/Mississippi/05/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI359476 A/Boston/DOA75/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI335948 A/Santiago/18454/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI335923 A/Iowa/19/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI335861 A/Argentina/676/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI325969 A/Mexico City/WRAIR3579T/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI319740 A/Minnesota/09/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI319656 A/California/22/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI319128 A/Illinois/NHRC0002/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI316114 A/Mississippi/03/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI316040 A/District of Columbia/03/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI309616 A/Texas/05/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI309493 A/Maryland/07/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI309464 A/Wyoming/04/2011 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI302319 A/Iowa/12/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI302304 A/Iowa/11/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI301737 A/Arkansas/03/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI301125 A/Nebraska/03/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI301121 A/Arkansas/05/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI301101 A/Texas/12/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI295227 A/Mexico/4674/2010 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI316028 A/Delaware/03/2011 (A/H3N2) segment 4 (HA) 2985.3 0.000000e+00 1673/1702 (98%)
EPI316236 A/Washington/06/2011 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI309581 A/Georgia/01/2011 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI309563 A/Delaware/02/2011 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI309387 A/Mexico/6605/2010 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI309362 A/Illinois/01/2010 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI302327 A/Iowa/19/2010 (A/H3N2) segment 4 (HA) 2983.5 0.000000e+00 1673/1702 (98%)
EPI511925 A/Tennessee/F2018A/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI511918 A/Tennessee/F2018/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI511802 A/Tennessee/F2059/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI496831 A/Peru/PER285/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI496382 A/Peru/PER220/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI495328 A/Peru/PER160/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI495076 A/Peru/PER123/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI427107 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI426917 A/Florida/11/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI361046 A/Boston/DOA15/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI359468 A/Boston/DOA86/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342333 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342330 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342303 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342300 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342297 A/North Dakota/06/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342205 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342203 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342197 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI342195 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI335946 A/Santiago/14944/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI335943 A/Santiago/13652/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI334570 A/Mexico City/WRAIR3569N/2010(H3N2) (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI326278 A/Chile/72/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325961 A/Mexico City/WRAIR3579N/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325937 A/Mexico City/WRAIR3577T/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325929 A/Mexico City/WRAIR3571N/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325905 A/Mexico City/WRAIR3569T/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325889 A/Mexico City/WRAIR3568N/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI325881 A/Mexico City/WRAIR3568N/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI320357 A/California/NHRC0004/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI320349 A/California/NHRC0003/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI320341 A/California/NHRC0002/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI319650 A/Arizona/03/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI319248 A/Ireland/11M27357/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI316239 A/Wisconsin/09/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI316209 A/Vermont/03/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI316200 A/Texas/06/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI316013 A/Alabama/01/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309455 A/Colorado/01/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309431 A/Texas/26/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309412 A/California/03/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1674/1703 (98%)
EPI309405 A/Costa Rica/0096/2001 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309394 A/Nebraska/02/2011 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309373 A/Texas/23/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI301759 A/Oklahoma/02/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI301111 A/California/27/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI301047 A/Georgia/19/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI301027 A/Colorado/05/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI301018 A/Florida/27/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI295199 A/Belize/3715/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI295193 A/Texas/07/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI291556 A/Costa Rica/6696/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI287082 A/Panama/307149/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI279988 A/Mexico/4056/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI279979 A/Barbados/170/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI279967 A/Pennsylvania/08/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI279961 A/Florida/11/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI278766 A/Dominican Republic/4319/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI278760 A/Panama/307149/2010 (A/H3N2) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI309557 A/Vermont/03/2011 (A/H3N2) segment 4 (HA) 2979.8 0.000000e+00 1672/1702 (98%)
EPI316082 A/Kansas/03/2011 (A/H3N2) segment 4 (HA) 2977.9 0.000000e+00 1672/1702 (98%)
EPI302295 A/Delaware/06/2010 (A/H3N2) segment 4 (HA) 2977.9 0.000000e+00 1672/1702 (98%)
EPI295154 A/Florida/18/2010 (A/H3N2) segment 4 (HA) 2977.9 0.000000e+00 1672/1702 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 10:59 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI406548 A/swine/Illinois/A01203922/2012 (A/H1N1) segment 6 (NA) 2531.0 0.000000e+00 1397/1411 (99%)
EPI509533 A/swine/Iowa/A01410129/2014 (A/H1N1) segment 6 (NA) 2481.2 0.000000e+00 1389/1411 (98%)
EPI384558 A/swine/Illinois/A01047924/2011 (A/H1N1) segment 6 (NA) 2470.1 0.000000e+00 1385/1410 (98%)
EPI368328 A/swine/Illinois/A01047930/2011 (A/H1N1) segment 6 (NA) 2459.0 0.000000e+00 1383/1410 (98%)
EPI384609 A/swine/Oklahoma/A01134903/2011 (A/H1N1) segment 6 (NA) 2447.9 0.000000e+00 1381/1410 (97%)
EPI371693 A/swine/Oklahoma/A01134908/2011 (A/H1N1) segment 6 (NA) 2447.9 0.000000e+00 1381/1410 (97%)
EPI368354 A/swine/Oklahoma/A01134906/2011 (A/H1N1) segment 6 (NA) 2447.9 0.000000e+00 1381/1410 (97%)
EPI390806 A/swine/Oklahoma/A01134901/2011 (A/H1N1) segment 6 (NA) 2442.4 0.000000e+00 1378/1407 (97%)
EPI384257 A/swine/Illinois/A01076767/2010 (A/H1N1) segment 6 (NA) 2427.6 0.000000e+00 1372/1402 (97%)
EPI491930 A/swine/Texas/SG1162/2003 (A/H1N1) segment 6 (NA) 2231.9 0.000000e+00 1346/1414 (95%)
EPI491598 A/swine/Texas/SG1162/2003 (A/H1N1) segment 6 (NA) 2231.9 0.000000e+00 1346/1414 (95%)
EPI492127 A/swine/Texas/SG1187/2004 (A/H1N1) segment 6 (NA) 2193.1 0.000000e+00 1338/1413 (94%)
EPI491954 A/swine/Texas/SG1187/2004 (A/H1N1) segment 6 (NA) 2193.1 0.000000e+00 1338/1413 (94%)
EPI490327 A/swine/Texas/00244/2004 (A/H1N1) segment 6 (NA) 2193.1 0.000000e+00 1339/1414 (94%)
EPI492217 A/swine/Texas/00525/2005 (A/H1N1) segment 6 (NA) 2187.6 0.000000e+00 1337/1413 (94%)
EPI488587 A/swine/Oklahoma/SG1243/2006 (A/H1N1) segment 6 (NA) 2182.0 0.000000e+00 1337/1414 (94%)
EPI490432 A/swine/Texas/00867/2005 (A/H1N1) segment 6 (NA) 2176.5 0.000000e+00 1335/1413 (94%)
EPI488692 A/swine/Texas/01822/2007 (A/H3N1) segment 6 (NA) 2121.1 0.000000e+00 1326/1414 (93%)
EPI482807 A/Wisconsin/10/1998 (A/H1N1) segment 6 (NA) 2121.1 0.000000e+00 1326/1414 (93%)
EPI8419 A/Wisconsin/10/98 (A/H1N1) segment 6 (NA) 2115.5 0.000000e+00 1325/1414 (93%)
EPI488685 A/swine/Texas/SG1271/2007 (A/H1N1) segment 6 (NA) 2110.0 0.000000e+00 1324/1414 (93%)
EPI392830 A/swine/Mexico/Ver37/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392822 A/swine/Mexico/Ver31/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392815 A/swine/Mexico/Ver29/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392808 A/swine/Mexico/Qro35/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392800 A/swine/Mexico/Qro32/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392760 A/swine/Mexico/Mex19/2010 (A/H1N1) segment 6 (NA) 2104.5 0.000000e+00 1325/1416 (93%)
EPI392784 A/swine/Mexico/Mex52/2010 (A/H1N1) segment 6 (NA) 2100.8 0.000000e+00 1324/1416 (93%)
EPI491718 A/swine/Oklahoma/SG1188/2004 (A/H1N1) segment 6 (NA) 2049.1 0.000000e+00 1313/1414 (92%)
EPI490453 A/swine/Oklahoma/00801/2005 (A/H1N1) segment 6 (NA) 2049.1 0.000000e+00 1316/1417 (92%)
EPI165699 A/swine/Memphis/1/1990 (A/H1N1) segment 6 (NA) 2043.5 0.000000e+00 1314/1416 (92%)
EPI491606 A/swine/Texas/00195/2003 (A/H1N1) segment 6 (NA) 2038.0 0.000000e+00 1311/1414 (92%)
EPI77678 A/swine/California/T9001707/1991 (A/H1N1) segment 6 (NA) 2038.0 0.000000e+00 1313/1416 (92%)
EPI490663 A/swine/Oklahoma/00743/2005 (A/H1N1) segment 6 (NA) 2026.9 0.000000e+00 1312/1417 (92%)
EPI335019 A/swine/North Carolina/18161/2002 (A/H1N1) segment 6 (NA) 2021.4 0.000000e+00 1307/1413 (92%)
EPI240275 A/turkey/NC/19762/1988 (A/H1N1) segment 6 (NA) 2021.4 0.000000e+00 1310/1416 (92%)
EPI337491 A/swine/Illinois/SG1141/2003 (A/H1N1) segment 6 (NA) 2010.3 0.000000e+00 1306/1414 (92%)
EPI153507 A/swine/Ohio/75004/04 (A/H1N1) segment 6 (NA) 2010.3 0.000000e+00 1305/1413 (92%)
EPI165953 A/turkey/NC/17026/1988 (A/H1N1) segment 6 (NA) 2006.6 0.000000e+00 1308/1416 (92%)
EPI178962 A/swine/Wisconsin/1915/1988 (A/H1N1) segment 6 (NA) 2004.7 0.000000e+00 1307/1416 (92%)
EPI62753 A/swine/Wisconsin/1915/1988 (A/H1N1) segment 6 (NA) 2004.7 0.000000e+00 1307/1416 (92%)
EPI62526 A/swine/Iowa/17672/1988 (A/H1N1) segment 6 (NA) 2004.7 0.000000e+00 1308/1417 (92%)
EPI491622 A/swine/Kentucky/SG1167/2003 (A/H1N1) segment 6 (NA) 1999.2 0.000000e+00 1306/1416 (92%)
EPI178970 A/Swine/Indiana/1726/1988 (A/H1N1) segment 6 (NA) 1993.7 0.000000e+00 1305/1416 (92%)
EPI63960 A/swine/Iowa/31483/1988 (A/H1N1) segment 6 (NA) 1993.7 0.000000e+00 1306/1417 (92%)
EPI68596 A/Ohio/3559/1988 (A/H1N1 seasonal) segment 6 (NA) 1988.1 0.000000e+00 1302/1413 (92%)
EPI239972 A/Swine/Indiana/1726/1988 (A/H1N1) segment 6 (NA) 1982.6 0.000000e+00 1303/1416 (92%)
EPI180170 A/swine/North Carolina/9647/2003 (A/H1N1) segment 6 (NA) 1982.6 0.000000e+00 1304/1417 (92%)
EPI492148 A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 6 (NA) 1977.0 0.000000e+00 1302/1416 (91%)
EPI492067 A/swine/North Carolina/SG1168/2003 (A/H1N1) segment 6 (NA) 1977.0 0.000000e+00 1302/1416 (91%)
EPI491649 A/swine/North Carolina/SG1170/2003 (A/H1N1) segment 6 (NA) 1977.0 0.000000e+00 1302/1416 (91%)
EPI492144 A/swine/North Carolina/00237/2004 (A/H1N1) segment 6 (NA) 1971.5 0.000000e+00 1301/1416 (91%)
EPI492088 A/swine/North Carolina/SG1175/2003 (A/H1N1) segment 6 (NA) 1971.5 0.000000e+00 1301/1416 (91%)
EPI491962 A/swine/North Carolina/SG1202/2004 (A/H1N1) segment 6 (NA) 1971.5 0.000000e+00 1301/1416 (91%)
EPI180184 A/swine/North Carolina/26292/2003 (A/H1N1) segment 6 (NA) 1966.0 0.000000e+00 1301/1417 (91%)
EPI62865 A/swine/Maryland/23239/1991 (A/H1N1) segment 6 (NA) 1966.0 0.000000e+00 1300/1416 (91%)
EPI180178 A/swine/North Carolina/901/2003 (A/H1N1) segment 6 (NA) 1962.3 0.000000e+00 1299/1416 (91%)
EPI180189 A/swine/North Carolina/42577/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1299/1416 (91%)
EPI180187 A/swine/North Carolina/38767/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1300/1417 (91%)
EPI180182 A/swine/North Carolina/12869/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1299/1416 (91%)
EPI180176 A/swine/North Carolina/46130/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1300/1417 (91%)
EPI180172 A/swine/North Carolina/28126/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1298/1414 (91%)
EPI180162 A/swine/North Carolina/44012/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1299/1416 (91%)
EPI180160 A/swine/North Carolina/43951/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1300/1417 (91%)
EPI180156 A/swine/North Carolina/7571/2003 (A/H1N1) segment 6 (NA) 1960.4 0.000000e+00 1299/1416 (91%)
EPI491799 A/swine/Minnesota/SG1235/2005 (A/H1N1) segment 6 (NA) 1954.9 0.000000e+00 1294/1412 (91%)
EPI180190 A/swine/North Carolina/43110/2003 (A/H1N1) segment 6 (NA) 1954.9 0.000000e+00 1298/1416 (91%)
EPI180185 A/swine/North Carolina/35002/2003 (A/H1N1) segment 6 (NA) 1954.9 0.000000e+00 1299/1417 (91%)
EPI180180 A/swine/North Carolina/34562/2003 (A/H1N1) segment 6 (NA) 1954.9 0.000000e+00 1298/1416 (91%)
EPI180158 A/swine/North Carolina/43110/2003 (A/H1N1) segment 6 (NA) 1954.9 0.000000e+00 1298/1416 (91%)
EPI130943 A/WI/4754/1994 (A/H1N1 seasonal) segment 6 (NA) 1954.9 0.000000e+00 1300/1418 (91%)
EPI383485 A/swine/Hubei/02/2008 (A/H1N1) segment 6 (NA) 1949.3 0.000000e+00 1297/1416 (91%)
EPI180168 A/swine/North Carolina/47437/2003 (A/H1N1) segment 6 (NA) 1949.3 0.000000e+00 1297/1416 (91%)
EPI178954 A/Maryland/12/1991 (A/H1N1 seasonal) segment 6 (NA) 1949.3 0.000000e+00 1297/1416 (91%)
EPI73839 A/swine/Iowa/24297/1991 (A/H1N1) segment 6 (NA) 1949.3 0.000000e+00 1298/1417 (91%)
EPI68796 A/swine/Kansas/3024/1987 (A/H1N1) segment 6 (NA) 1949.3 0.000000e+00 1298/1417 (91%)
EPI490651 A/swine/North Carolina/00396/2004 (A/H1N1) segment 6 (NA) 1943.8 0.000000e+00 1297/1417 (91%)
EPI180174 A/swine/North Carolina/43904/2003 (A/H1N1) segment 6 (NA) 1943.8 0.000000e+00 1295/1414 (91%)
EPI180166 A/swine/North Carolina/46858/2003 (A/H1N1) segment 6 (NA) 1943.8 0.000000e+00 1298/1418 (91%)
EPI180154 A/swine/North Carolina/7386/2004 (A/H1N1) segment 6 (NA) 1943.8 0.000000e+00 1296/1416 (91%)
EPI98716 A/swine/MI/PU243/04 (A/H3N1) segment 6 (NA) 1943.8 0.000000e+00 1296/1416 (91%)
EPI62847 A/swine/Kansas/3228/1987 (A/H1N1) segment 6 (NA) 1940.1 0.000000e+00 1296/1417 (91%)
EPI491978 A/swine/Minnesota/00574/2005 (A/H1N1) segment 6 (NA) 1938.3 0.000000e+00 1297/1418 (91%)
EPI491791 A/swine/Minnesota/00574/2005 (A/H1N1) segment 6 (NA) 1938.3 0.000000e+00 1297/1418 (91%)
EPI490467 A/swine/North Carolina/SG1477/2005 (A/H1N1) segment 6 (NA) 1938.3 0.000000e+00 1295/1416 (91%)
EPI158920 A/turkey/IA/10271-3/1990 (A/H1N1) segment 6 (NA) 1938.3 0.000000e+00 1297/1418 (91%)
EPI124056 A/swine/North Carolina/36883/2002 (A/H1N1) segment 6 (NA) 1936.4 0.000000e+00 1296/1417 (91%)
EPI490667 A/swine/North Carolina/SG1229/2005 (A/H1N1) segment 6 (NA) 1932.7 0.000000e+00 1294/1416 (91%)
EPI476457 A/swine/Beijing/156/1991 (A/H1N1) segment 6 (NA) 1932.7 0.000000e+00 1295/1417 (91%)
EPI158912 A/turkey/IA/21089-3/1992 (A/H1N1) segment 6 (NA) 1932.7 0.000000e+00 1294/1416 (91%)
EPI124052 A/swine/Minnesota/37866/1999 (A/H1N1) segment 6 (NA) 1932.7 0.000000e+00 1294/1416 (91%)
EPI491775 A/swine/North Carolina/SG1226/2005 (A/H1N1) segment 6 (NA) 1927.2 0.000000e+00 1293/1416 (91%)
EPI490488 A/swine/North Carolina/00925/2005 (A/H1N1) segment 6 (NA) 1927.2 0.000000e+00 1294/1417 (91%)
EPI490474 A/swine/North Carolina/SG1478/2005 (A/H1N1) segment 6 (NA) 1927.2 0.000000e+00 1292/1415 (91%)
EPI490138 A/swine/Georgia/SG1251/2006 (A/H1N1) segment 6 (NA) 1927.2 0.000000e+00 1294/1417 (91%)
EPI490481 A/swine/North Carolina/SG1479/2005 (A/H1N1) segment 6 (NA) 1921.6 0.000000e+00 1293/1417 (91%)
EPI476458 A/swine/Beijing/216/1992 (A/H1N1) segment 6 (NA) 1921.6 0.000000e+00 1293/1417 (91%)
EPI153508 A/swine/Ohio/C62006/06 (A/H1N1) segment 6 (NA) 1921.6 0.000000e+00 1293/1417 (91%)
EPI490537 A/swine/North Carolina/01591/2007 (A/H1N1) segment 6 (NA) 1916.1 0.000000e+00 1292/1417 (91%)
EPI490558 A/swine/North Carolina/01514/2007 (A/H1N1) segment 6 (NA) 1910.6 0.000000e+00 1291/1417 (91%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 11:00 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI406547 A/swine/Illinois/A01203922/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI384276 A/swine/Illinois/A01076954/2010 (A/H1N2) segment 7 (MP) 1759.1 0.000000e+00 970/979 (99%)
EPI338513 A/swine/Indiana/A01049964/2011 (A/H1N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI332028 A/District of Columbia/INS527/2010 (A/H1N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI324826 A/swine/Iowa/A01049239/2010 (A/H1N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI308288 A/Cape May/WRAIR1653P/2009 (A/H1N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI308176 A/New Jersey/WRAIR1504P/2009 (A/H1N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI308136 A/New Jersey/WRAIR1499P/2009 (A/H1N1) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI240323 A/Florida/31/2009 (A/H1N1 pdm09) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI272580 A/KUMAMOTO/20/2010 (A/H1N1 pdm09) segment 7 (MP) 1755.4 0.000000e+00 971/982 (98%)
EPI537971 A/North Dakota/20/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI509534 A/swine/Iowa/A01410129/2014 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI476500 A/swine/Iowa/A01432991/2013 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI471745 A/swine/Thailand/LB160/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI471737 A/swine/Thailand/LB159/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI471721 A/swine/Thailand/LB158/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI471697 A/swine/Thailand/LB164/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI457519 A/swine/Kansas/13-108011/2013 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405733 A/Viet Nam/001-1889/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405717 A/Viet Nam/001-1716/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405709 A/Viet Nam/001-1424/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405677 A/Viet Nam/11032017/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405653 A/Viet Nam/11032006/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405645 A/Viet Nam/11032001/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405562 A/Viet Nam/13032074/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405554 A/Viet Nam/13032071/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405540 A/Viet Nam/13032060/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405524 A/Viet Nam/13032051/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405508 A/Viet Nam/13032044/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405500 A/Viet Nam/13032040/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405476 A/Viet Nam/13032035/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405453 A/Viet Nam/13032016/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405437 A/Viet Nam/13032011/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405429 A/Viet Nam/13032009/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405421 A/Viet Nam/13032008/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405405 A/Viet Nam/13032001/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI405320 A/Viet Nam/001-1890/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI404197 A/Viet Nam/15032002/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI399552 A/swine/Minnesota/A01300999/2012 (A/H3N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI399490 A/swine/Minnesota/A01301000/2012 (A/H3N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI398128 A/swine/Iowa/A01203809/2012 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI392378 A/Scotland/Paisley_413960/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI392371 A/Scotland/Paisley_412182/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI391458 A/swine/Iowa/A01203126/2012 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI391457 A/swine/Iowa/A01203125/2012 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI391335 A/swine/Iowa/A01202727/2011 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI390968 A/swine/Iowa/A01049451/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI384357 A/swine/USA/A01076112/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 969/979 (98%)
EPI384350 A/swine/USA/A01076111/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 969/979 (98%)
EPI384295 A/swine/Illinois/A01047079/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 969/979 (98%)
EPI384289 A/swine/Illinois/A01047048/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 969/979 (98%)
EPI380533 A/Singapore/ON2269/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI379291 A/Singapore/GP4218/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI379261 A/Singapore/GP4000/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI379104 A/Singapore/GP3093/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI378872 A/Singapore/GP2224/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI376273 A/Scotland/Paisley_425827/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI374144 A/Malaysia/2156796/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI371675 A/swine/Oklahoma/A01134908/2011 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI371669 A/swine/Minnesota/A01134333/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI371668 A/swine/Minnesota/A01134332/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI369074 A/swine/Minnesota/A01047604/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI367707 A/swine/Minnesota/A01240127/2011 (A/H3N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI367246 A/Dundgobi/0381/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI353670 A/swine/Mississippi/A01049443/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI351209 A/Hubei/99/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI351127 A/Zhejiang/87/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI351100 A/Zhejiang/84/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI347008 A/Hawaii/34/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI341735 A/swine/Iowa/A01049980/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI341734 A/swine/Illinois/A01049981/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI341733 A/swine/Iowa/A01202023/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI341725 A/swine/Iowa/A01202063/2011 (A/H0N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338524 A/swine/Iillinois/A01049871/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338523 A/swine/Iillinois/A01049872/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338521 A/swine/Iowa/A01049894/2011 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338484 A/swine/Iowa/A01049640/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338476 A/swine/Iowa/A01049718/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338473 A/swine/Iowa/A01049723/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338471 A/swine/Iowa/A01049726/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338470 A/swine/Iowa/A01049728/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI338466 A/swine/Iowa/A01049858/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI332905 A/Pune/NIV0953725/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI330978 A/New Mexico/07/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI324839 A/swine/Iowa/A01049450/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI324447 A/Illinois/NHRC0001/2011 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI320221 A/Bretagne/7639/2009 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI320088 A/New Mexico/06/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI320080 A/New Mexico/05/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI320072 A/New Mexico/04/2011 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI316959 A/swine/Iowa/A01049037/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI315847 A/swine/South Dakota/6/2011 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI312700 A/swine/Minnesota/239106/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI312684 A/swine/Minnesota/226128/2010 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI308721 A/Berlin/INS362/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI308496 A/Budapest/WRAIR2393T/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI308184 A/New Jersey/WRAIR1506P/2009 (A/H1N1) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI307831 A/swine/South Dakota/4/2010 (A/H1N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI302150 A/New York/11/2010 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI302130 A/California/31/2010 (A/H1N1 pdm09) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Sep 06, 2014 11:05 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ941386 1701 bp cRNA linear VRL 05-SEP-2014
DEFINITION Influenza A virus (A/swine/USA/2014001372/2014(H3N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ941386
VERSION KJ941386.1 GI:660301716
KEYWORDS .
SOURCE Influenza A virus (A/swine/USA/2014001372/2014(H3N1))
ORGANISM Influenza A virus (A/swine/USA/2014001372/2014(H3N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Deike,P.H., Zhang,J. and Phillip,G.C.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2014) Veterinary Diagnostic and Production Animal
Medicine, Iowa State University, 1600 South 16th Street, Ames, IA
50011, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/USA/2014001372/2014(H3N1))"
/mol_type="viral cRNA"
/strain="A/swine/USA/2014001372/2014"
/serotype="H3N1"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1506991"
/segment="4"
/country="USA"
/collection_date="09-Jan-2014"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AID70334.1"
/db_xref="GI:660301717"
/translation="MKTIIALSYILCLVFAQKLPSNDNNMATLCLGHHAVPNGTIVKT
ITNDQIEVTNATELVQSSSAGEICNSPHQILDGENCTLIDALLGDPQCDGFQNKNWDL
FVERSKAHSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWTGVTQNGASSACKRRSN
KSFFSRLNWLTHLNSKYPALEVTMPNNEQFDKLYIWGVHHPATDKDQISLYAQAAGRI
IVSTKRSQQAVIPNIGSRPRVRDIPSRVSIYWTIVRPGDILLIXSTGNLIAPRGYFKI
RSGKSSIMRSDAPIGKCNSACITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNIPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGRGQAADLKSTQAAIDQ
INGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEALNNRFQIKGVELKSEYKDWILWISFAISCFLLCAALLGFIMWACQKGNIKCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 85..1698
/gene="HA"
/note="Haemagglutinin; Region: Hemagglutinin; pfam00509"
/db_xref="CDD:249917"
misc_feature 1..1701
/db_xref="IRD:IRD-2014001372.4"
ORIGIN
1 atgaagacta tcattgcttt gagctacatt ctatgtctgg ttttcgctca aaaacttcct
61 agtaatgaca acaacatggc aacgctgtgc cttggacacc atgcagtgcc aaacggaacg
121 atagtgaaaa caatcacgaa tgaccaaatt gaagttacta atgctactga gctggttcag
181 agttcctctg caggtgaaat atgcaacagt cctcatcaga tccttgatgg agaaaactgc
241 acactaatag atgctctatt gggagatcct cagtgtgatg gcttccaaaa caagaactgg
301 gacctttttg ttgaacgaag caaagcccac agcaactgtt acccttatga tgtgccggat
361 tatgcctccc ttaggtcact agttgcctca tccggtacac tggagtttaa caatgaaagc
421 ttcaattgga ctggagtaac tcaaaacgga gcaagctctg cttgcaaaag gagatccaac
481 aaaagtttct ttagtagatt gaattggttg actcacttaa actccaaata cccagcattg
541 gaagtgacta tgccaaacaa tgaacaattt gacaaattgt acatttgggg ggttcaccac
601 ccggctacgg acaaggacca aatctccctg tatgctcaag cagcaggaag aatcatagta
661 tctaccaaaa gaagccaaca agctgtaatt ccgaatatcg ggtctagacc cagagtaagg
721 gatatcccta gcagagtaag catctattgg acaatagtaa gaccgggaga catacttttg
781 attaamagca cagggaatct aattgctcct aggggttact tcaaaatacg aagtgggaaa
841 agctcaataa tgagatcaga tgcacccatt ggcaaatgca attctgcatg catcactcca
901 aatggaagca ttcccaatga caaaccattc caaaatgtaa acaggatcac atacggggcc
961 tgtcccagat atgttaagca aaacactctg aaattggcaa caggaatgag aaatatacca
1021 gagaaacaaa ctagaggcat atttggcgca atagctggtt tcatagaaaa tggttgggag
1081 ggaatggtgg atggttggta cggtttcagg catcaaaatt ctgaggggag gggacaagca
1141 gcagatctca aaagcactca agcagcaatc gatcaaatca atgggaagct gaatagattg
1201 atcgggaaaa ccaacgagaa attccatcag attgaaaaag aattttcaga agtcgaaggg
1261 agaattcagg accttgagaa atatgttgag gacactaaaa tagatctctg gtcatacaac
1321 gcggagcttc ttgttgccct ggagaaccaa cacacaattg atctaactga ctcagaaatg
1381 aacaaattgt ttgaaaaaac aaagaagcaa ctgagggaaa atgctgagga tatgggcaat
1441 ggttgtttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaacgga
1501 acttatgacc acgatgtgta cagagatgaa gcattaaaca accgattcca gatcaaggga
1561 gttgagctga agtcagagta caaagattgg attctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgctgcttt gttggggttc atcatgtggg cctgccaaaa aggcaacatt
1681 aagtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Majestic-12 [Bot], Yahoo [Bot] and 55 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group