Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Oct 20, 2017 10:13 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Mon Oct 13, 2014 10:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A full sequence from a 2014 D68 case in St Louis, EV-D68_STL_2014_12, has been released by Washington University.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Oct 13, 2014 10:21 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM881710 7125 bp RNA linear VRL 09-OCT-2014
DEFINITION Enterovirus D68 strain EV-D68_STL_2014_12, complete genome.
ACCESSION KM881710
VERSION KM881710.1 GI:695778432
DBLINK BioProject: PRJNA263037
BioSample: SAMN03093439
KEYWORDS .
SOURCE Enterovirus D68 (EV-D68)
ORGANISM Enterovirus D68
Viruses; ssRNA positive-strand viruses, no DNA stage;
Picornavirales; Picornaviridae; Enterovirus; Enterovirus D.
REFERENCE 1 (bases 1 to 7125)
AUTHORS Wylie,K.M., Wylie,T.T., Orvedahl,A., Butler,R., Herter,B.,
Wilson,R.K. and Storch,G.A.
TITLE Genomic Characterization of Enterovirus D68 from St. Louis
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7125)
AUTHORS Wylie,K.M., Wylie,T.T., Orvedahl,A., Butler,R., Herter,B.,
Wilson,R.K. and Storch,G.A.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2014) The Genome Institute, Washington University
School of Medicine, 4444 Forest Park Avenue, St. Louis, MO 63108,
USA
COMMENT ##Assembly-Data-START##
Assembly Method :: IDBA-UD 1.1.0
Sequencing Technology :: Illumina HiSeq
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..7125
/organism="Enterovirus D68"
/mol_type="genomic RNA"
/strain="EV-D68_STL_2014_12"
/isolation_source="nasopharynx"
/host="Homo sapiens"
/db_xref="taxon:42789"
/country="USA: St. Louis, Missouri"
/collection_date="2014"
5'UTR 1..534
CDS 535..7101
/note="NA50_001"
/codon_start=1
/product="polyprotein"
/protein_id="AIT18931.1"
/db_xref="GI:695778433"
/translation="MGAQVTRQQTGTHENANIATNGSHITYNQINFYKDSYAASASKQ
DFSQDPSKFTEPVVEGLKAGAPVLKSPSAEACGYSDRVLQLKLGNSAIVTQEAANYCC
AYGEWPNYLPDHEAVAIDKPTQPETATDRFYTLKSVKWETGSTGWWWKLPDALNNIGM
FGQNVQHHYLYRSGFLIHVQCNATKFHQGALLVVAIPEHQRGAHNTNTSPGFDDIMKG
EEGGTFNHPYVLDDGTSLACATIFPHQWINLRTNNSATIVLPWMNAAPMDFPLRHNQW
TLAIIPVVPLGTRTTSSMVPITVSIAPMCCEFNGLRHAITQGVPTYLLPGSGQFLTTD
DHSSAPALPCFNPTPEMHIPGQVRNMLEVVQVESMMEINNTESAVGMERLKVDISALT
DVDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCY
TPPGGSCPTTRETAMLGTHIVWDFGLQSSVTLIIPWISGSHYRMFNNDAKSTNANVGY
VTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQLDHLHAAEAAYQIE
SIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVE
NFLSRAALVSKRSFEYKDHTSSAAQADKNFFKWTINTRSFVQLRRKLELFTYLRFDAE
ITILTTVAVNGSGNNTYVGLPDLTLQAMFVPTGALTPEKQDSFHWQSGSNASVFFKIS
DPPARITIPFMCINSAYSVFYDGFAGFEKNGLYGINPADTIGNLCVRIVNEHQPVGFT
VTVRVYMKPKHIKAWAPRPPRTLPYMSIANANYKGKERAPNALNAIIGNRDSVKTMPH
NIVNTGPGFGGVFVGSFKIINYHLATTEERQSAIYVDWQSDVLVTPIAAHGRHQIARC
KCNTGVYYCRHKNRSYPICFEGPGIQWIEQNEYYPARYQTNVLLAVGPAEAGDCGGLL
VCPHGVIGLLTAGGGGIVAFTDIRNLLWLDTDAMEQGITDYIQNLGNAFGAGFTETIS
NKAKEVQDMLIGESSLLEKLLKALIKIISALVIVIRNSEDLVTVTATLALLGCHDSPW
SYLKQKVCSYLGIPYVPRQGESWLKKFTEACNALRGLDWLSQKIDKFINWLKTKILPE
AREKYEFVQRLKQLPVIENQVSTIEHSCPTTEQQQALFNNVQYYSHYCRKYAPLYAVE
AKRVVALEKKINNYIQFKSKSRIEPVCLIIHGSPGTGKSVASNLIARAITEKLGGDIY
SLPPDPKYFDGYKQQTVVLMDDLMQNPDGNDISMFCQMVSTVDFIPPMASLEEKGTLY
TSPFLIATTNAGSIHAPTVSDSKALSRRFKFDVDIEVTDSYKDSNKLDMSRAVEMCKP
DGCAPTNYKRCCPLICGKAIQFRDRRTNARSTIDMLVTDIIKEYRTRNSTQDKLEALF
QGPPQFKEIKISVTPDTPAPDAINDLLRSVDSQEVRDYCQKKGWIVVHPSNELIVEKH
ISRAFITLQAIATFVSIAGVVYVIYKLFAGIQGPYTGIPNPKPKVPSLRTAKVQGPGF
DFAQAIMKKNTVIARTEKGEFTMLGVYDRVAVIPTHASVGETIYINDVETKVLDACAL
RDLTDTNLEITIVKLDRNQKFRDIRHFLPRYEDDYNDAVLSVHTSKFPNMYIPVGQVT
NYGFLNLGGTPTHRILMYNFPTRAGQCGGVVTTTGKVIGIHVGGNGAQGFAAMLLHSY
FSDTQGEIVSSEKSGVCINAPAKTKLQPSVFHQVFEGSKEPAVLNPKDPRLKTDFEEA
IFSKYTGNKIMLMDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYGMDGLEALDLTTS
AGFPYLLQGKKKRDIFNRHTRDTSEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGKS
RLIEASSLNDSVAMRVAFGNLYATFHNNPGTATGSAVGCDPDIFWSKIPILLDGEIFA
FDYTGYDASLSPVWFACLKKVLIKLGYTHQTSFIDYLCHSVHLYKDKKYIVNGGMPSG
SSGTSIFNTMINNIIIRTLLIRVYKGIDLDQFKMIAYGDDVIASYPHKIDPGLLAEAG
KQYGLVMTPADKGTSFIDTNWENVTFLKRYFRADDQYPFLIHPVMPMKEIHESIRWTK
DPRNTQDHVRSLCYLAWHNGEEAYNEFCRKIRSVPVGRALTLPAYSSLRRKWLDSF"
mat_peptide 535..741
/product="VP4 polypeptide"
mat_peptide 742..1485
/product="VP2 polypeptide"
mat_peptide 1486..2208
/product="VP3 polypeptide"
mat_peptide 2209..3111
/product="VP1 polypeptide"
mat_peptide 3112..3558
/product="p2A protease"
mat_peptide 3559..3855
/product="p2B polypeptide"
mat_peptide 3856..4848
/product="p2C polypeptide"
mat_peptide 4849..5112
/product="p3A polypeptide"
mat_peptide 5113..5178
/product="p3B VPg polypeptide"
mat_peptide 5179..5727
/product="p3C protease"
mat_peptide 5728..7098
/product="p3D RNA polymerase"
3'UTR 7102..7125
ORIGIN
1 caagcactcc tgtctccccg gtgaggttgt ataaactgtt cccacggttg aaaacaacct
61 atccgttatc cgctatagta cttcgagaaa cctagtacca cctttggatt gttgacgcgt
121 tgcgctcagc acactaaccc gtgtgtagct tgggtcgatg agtctggaca tacctcactg
181 gcgacagtgg tccaggctgc gttggcggcc tactcatggt gaaagccatg agacgctaga
241 catgaacaag gtgtgaagag tctattgagc tactatagag tcctccggcc cctgaatgcg
301 gctaatccta accatggagc aagtgctcac aggccagtga gttgcttgtc gtaatgcgca
361 agtccgtggc ggaaccgact actttgggtg tccgtgtttc actttttact tttatgactg
421 cttatggtga caatttgata ttgttaccat ttagcttgtc aaatcaattg caaaagatcc
481 taaatcttat ttatcaactt gcatcttgat aactttaatt tgaaaatttt aacaatggga
541 gctcaggtta ctagacaaca aactggcact catgaaaatg ccaacattgc cacaaatgga
601 tctcatatca catacaatca gataaacttt tacaaggata gctatgcggc ttcagccagc
661 aagcaggatt tttcacagga cccatcaaaa ttcactgaac cagtagtgga aggtttaaaa
721 gcaggggcgc cagttttgaa atctcctagt gctgaggcat gtggctacag tgatagagta
781 ttacagctca aattaggaaa ttcagctatt gtcacccagg aagcagcgaa ctactgctgc
841 gcttatggtg aatggcccaa ttacttacca gaccatgaag cagtagccat tgataaacct
901 acacaaccag aaactgctac agatagattc tacactttga aatcagtcaa atgggaaact
961 ggaagcacag gatggtggtg gaaactaccc gatgcactga ataatatagg catgtttgga
1021 cagaatgtgc agcatcacta cctatataga tctggtttct tgattcatgt gcagtgtaat
1081 gccacaaaat tccatcaagg tgccttatta gtggtagcaa ttccagaaca tcagagggga
1141 gcgcacaaca ccaacactag cccagggttt gatgatataa tgaaaggtga agaaggaggg
1201 accttcaatc atccatatgt ccttgatgat ggaacatcat tggcttgtgc gacgatattt
1261 ccacatcagt ggataaatct gagaaccaac aattcagcaa caattgttct tccctggatg
1321 aatgctgctc caatggattt cccacttaga cataatcagt ggacgctagc aataatacca
1381 gtggtgccat taggtacgcg tacaacatca agtatggtcc caataacagt ttcaatcgct
1441 ccaatgtgtt gtgagtttaa tggacttaga cacgccatta ctcaaggtgt cccaacatac
1501 cttttaccag gctcgggaca attcctaaca actgatgatc atagctctgc accagctctc
1561 ccgtgtttca acccaactcc agaaatgcat atcccagggc aggtccgtaa catgctagaa
1621 gtggtccaag tggaatcaat gatggagatt aataacacag aaagtgcagt tggcatggag
1681 cgtcttaagg ttgatatatc agcattgaca gatgtcgatc aattgttatt caacattcca
1741 ctggacatac agttggatgg gccacttaga aacactttgg taggaaacat atctagatat
1801 tacactcatt ggtctggatc cctagaaatg acgtttatgt tttgtggcag cttcatggca
1861 acgggaaaat taatcctgtg ctatactcct ccaggtggat catgcccgac aaccagagag
1921 accgccatgt taggtacaca tattgtttgg gattttggat tacaatctag tgtaaccctg
1981 ataatacctt ggattagtgg atcccactac aggatgttta ataatgatgc taagtcaact
2041 aatgccaacg ttggctatgt cacttgtttt atgcagacca atctgatagt ccccagtgaa
2101 tcctctgaca cgtgttcctt gatagggttc atagcagcaa aagatgattt ctccctcaga
2161 ttaatgagag acagccctga cattggacaa ctagaccatt tacatgcagc agaggcagcc
2221 taccagatcg agagcatcat caaaacagcg accgacactg tgaaaagtga gattaatgct
2281 gaacttggtg tggtccctag cttaaatgca gttgaaacag gtgcaacttc taacactgaa
2341 ccagaagaag ccatacaaac tcgcacagtg ataaatcagc acggtgtatc cgagactcta
2401 gtggagaatt ttctcagtag agcagctttg gtatcaaaga gaagttttga atacaaagat
2461 catacttcgt ctgcagcaca agcagacaag aactttttca aatggacaat taacaccaga
2521 tcctttgtac agttaagaag aaaattagaa ttattcacat accttagatt tgatgctgag
2581 atcactatac tcacaactgt agcagtgaat ggtagtggta ataatacata cgtgggtctt
2641 cctgacttga cactccaagc aatgtttgta cccactggtg ctcttacccc agaaaaacag
2701 gactcattcc actggcagtc aggcagtaat gctagtgtat tctttaaaat ctccgacccc
2761 ccagccagaa taaccatacc ttttatgtgc attaactcag catactcagt tttttatgat
2821 ggctttgccg gatttgagaa aaacggtctg tatggaataa atccagctga cactattggt
2881 aacttatgtg ttagaatagt gaatgaacac caaccagttg gtttcacagt gaccgttagg
2941 gtttacatga agcctaaaca cataaaagca tgggcaccac gaccaccacg aactttgcca
3001 tatatgagta ttgcaaatgc aaattacaaa ggtaaagaaa gagcaccaaa tgcgctcaat
3061 gctataattg gcaatagaga cagtgtcaaa accatgcctc ataatatagt gaacactggt
3121 ccaggcttcg gaggagtttt tgtagggtct ttcaaaataa tcaactatca cttggccact
3181 acagaagaga gacagtcagc tatctatgtg gattggcaat cagacgtctt ggttaccccc
3241 attgctgctc atggaaggca ccaaatagca agatgcaagt gcaacacagg ggtttactat
3301 tgtaggcaca aaaacagaag ttacccgatt tgctttgaag gcccagggat tcaatggatt
3361 gaacaaaatg aatattaccc agcaaggtac cagaccaatg tactattggc agttggtcct
3421 gcggaagcag gagattgcgg tggtttacta gtttgtccac atggggtaat cggtcttctt
3481 acagcaggag ggggtggaat tgtagctttc actgatatca ggaatttgct atggttagat
3541 actgatgcta tggaacaagg cattactgat tatattcaaa atcttggtaa tgcctttgga
3601 gcaggattta cagaaacaat ctctaataaa gccaaggaag tgcaagatat gctaattgga
3661 gagagttcac tattagaaaa attgttaaaa gctctaatca aaatcatatc agcattagta
3721 attgtaatca gaaactcaga agatttagtc acagtcacag ccacactagc attgttggga
3781 tgccatgatt caccatggag ctacttgaaa cagaaggtat gttcatactt aggtattcct
3841 tatgtaccta gacagggtga atcgtggctt aagaaattca cagaggcatg caatgctctt
3901 agaggtctgg attggctatc gcaaaagata gataaattca tcaactggct taaaaccaaa
3961 atattaccag aagctaggga gaaatatgaa tttgtgcaaa ggctcaaaca gttaccggtg
4021 atagaaaacc aagttagtac aatcgagcat agctgcccaa caacagaaca acaacaggcc
4081 ttattcaaca acgtccaata ctattcacac tactgtagaa agtacgcacc actttacgca
4141 gtggaagcaa agagggtagt agctcttgaa aagaaaataa acaactacat ccagttcaag
4201 tccaaatctc gcattgaacc ggtttgttta ataatacatg gctctccagg aactggcaag
4261 tcagtggctt caaatttaat tgccagggct atcacagaga aattgggggg ggacatttat
4321 tccttgcctc cagaccctaa atattttgat ggatacaaac agcaaacagt ggtcctcatg
4381 gatgatttaa tgcaaaatcc agatgggaat gacatatcta tgttctgcca aatggtctcc
4441 actgtagatt tcataccccc aatggctagt ttggaggaaa aaggaactct atacaccagt
4501 ccatttttaa tagctactac caatgctggc tcaatacatg caccaactgt atcagactca
4561 aaggctttgt cacgcagatt taaatttgac gtggacattg aagtcacaga ttcatacaag
4621 gactcaaata aattggatat gtcaagggca gtcgagatgt gcaaaccaga tggctgtgcc
4681 cccaccaatt acaaaagatg ctgcccattg atctgtggaa aggctatcca attcagagat
4741 cgcagaacta atgcaagatc cactattgat atgctagtaa ctgatattat aaaggaatat
4801 agaaccagaa acagtacaca ggataagctg gaagctctgt ttcaggggcc tccacagttt
4861 aaagagatca aaatttcagt caccccagat acaccagctc ctgatgctat aaatgacctt
4921 cttaggtcag tggattctca agaagttagg gattattgcc aaaagaaagg atggattgta
4981 gtacacccat caaatgagct aatagtagaa aaacacatta gtagagcttt tattactcta
5041 caagccattg ccacctttgt atcaatagct ggtgtagttt atgttatata caaacttttt
5101 gctggcattc agggtccata cacaggaatc cccaatccta aacctaaagt accctctctc
5161 agaacagcta aagtgcaagg accagggttc gattttgcac aagccataat gaagaaaaat
5221 accgtcattg caaggactga aaagggtgag ttcaccatgc tgggtgtata tgatagggta
5281 gcggtcatcc ccacacacgc atctgttgga gaaaccattt acattaatga tgtagagact
5341 aaagttttag atgcgtgtgc acttagagac ttgactgata caaacttaga gataaccata
5401 gtcaaattag accgtaatca aaaatttaga gatatcagac attttctgcc cagatatgag
5461 gatgattaca atgacgctgt gcttagcgta catacatcaa aattcccaaa tatgtatatc
5521 ccagttggac aagtcaccaa ttatggcttc ttgaacctag gtggtacacc gacgcaccgc
5581 attttaatgt ataacttccc aacaagagct ggccagtgtg gtggtgtggt gacaactaca
5641 ggtaaggtga taggaataca tgtaggtgga aatggagctc aaggatttgc agcaatgcta
5701 ctacactctt acttttccga tacacaaggt gagatagtta gtagtgaaaa gagtggggtg
5761 tgcattaacg caccggcaaa gactaaactc caacctagtg ttttccatca agtttttgaa
5821 ggttcaaagg aaccagcagt tctcaatcca aaagatccta ggcttaaaac agatttcgag
5881 gaggccattt tctcaaagta cacaggtaac aaaattatgt taatggatga gtacatggaa
5941 gaggcagtgg atcattatgt ggggtgttta gaaccattag acatcagtgt ggatcccata
6001 cccctggaaa gtgccatgta tggaatggat ggccttgagg cattagactt aactaccagt
6061 gcaggattcc cttacttact acaagggaag aagaaaaggg atatatttaa tagacatact
6121 agagacacca gtgaaatgac aaaaatgtta gagaaatatg gagttgacct accttttgta
6181 acctttgtaa aagatgagct tagatcaaga gaaaaagttg aaaaagggaa atcacgcctg
6241 attgaggcca gttccttgaa tgactcagtt gctatgagag ttgcctttgg aaacctttac
6301 gccacatttc acaacaatcc aggtacagca actggtagtg cagttggttg tgatccagat
6361 atattttggt caaaaatccc tattttgtta gatggagaaa tctttgcttt tgactacact
6421 ggttatgatg ctagtttgtc accagtgtgg tttgcctgct taaagaaagt tctaattaag
6481 ttaggttaca cacatcaaac gtcttttata gattatttgt gtcattcagt acatttatat
6541 aaggacaaaa aatacatagt taatggtgga atgccctctg gttcttcagg caccagcata
6601 ttcaacacta tgatcaacaa tataatcata agaactttat taattagggt ttacaaaggc
6661 atagacctgg accagttcaa aatgattgcc tatggggatg atgttattgc tagctaccca
6721 cataagattg atccaggttt gctggcagaa gcaggtaaac agtatggatt agtaatgacg
6781 ccagcagaca aaggaaccag ttttattgac acaaattggg aaaatgtaac tttcttaaaa
6841 agatatttca gagcagatga tcaatacccc tttctcatac atccagtgat gccaatgaaa
6901 gagatacatg aatctattag atggactaaa gatcccagaa acacacagga tcatgttagg
6961 tctttgtgct acctcgcatg gcataatgga gaggaggctt ataatgaatt ttgcagaaaa
7021 atcagaagtg tgcctgtggg aagagcattg acactacctg catactctag tcttagacgg
7081 aaatggttag attcgttcta gacaactcta attgaaaccc aagtt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Oct 13, 2014 10:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Select seq gb|KM881710.1| Enterovirus D68 strain EV-D68_STL_2014_12, complete genome 12850 12850 100% 0.0 100% KM881710.1
Select seq gb|KM851225.1| Enterovirus D68 strain US/MO/14-18947, complete genome 12760 12760 100% 0.0 99% KM851225.1
Select seq gb|KM851228.1| Enterovirus D68 strain US/MO/14-18950, complete genome 12709 12709 100% 0.0 99% KM851228.1
Select seq gb|KM851227.1| Enterovirus D68 strain US/MO/14-18949, complete genome 12664 12664 100% 0.0 99% KM851227.1
Select seq gb|KM851226.1| Enterovirus D68 strain US/MO/14-18948, complete genome 12628 12628 100% 0.0 99% KM851226.1
Select seq gb|KM361523.1| Enterovirus sp. isolate CU134 polyprotein gene, partial cds 11905 11905 98% 0.0 98% KM361523.1
Select seq gb|KM361524.1| Enterovirus sp. isolate CU171 polyprotein gene, partial cds 11863 11863 98% 0.0 98% KM361524.1
Select seq gb|KM851229.1| Enterovirus D68 strain US/KY/14-18951, complete genome 10929 10929 96% 0.0 95% KM851229.1
Select seq gb|KM851230.1| Enterovirus D68 strain US/IL/14-18952, complete genome 10646 10646 96% 0.0 95% KM851230.1
Select seq gb|EF107098.1| Human enterovirus 68 isolate 37-99 from France, complete genome 10617 10617 100% 0.0 93% EF107098.1
Select seq dbj|AB601883.2| Human enterovirus 68 genomic RNA, complete genome, strain: JPOC10-378 10417 10417 100% 0.0 92% AB601883.2
Select seq dbj|AB601882.2| Human enterovirus 68 genomic RNA, complete genome, strain: JPOC10-290 10406 10406 100% 0.0 92% AB601882.2
Select seq gb|JX101846.1| Human enterovirus 68 strain NYC403 from USA, complete genome 9869 9869 100% 0.0 91% JX101846.1
Select seq dbj|AB601885.1| Human enterovirus 68 gene for polyprotein, complete cds, strain: JPOC10-404 9820 9820 94% 0.0 92% AB601885.1
Select seq gb|KF726085.1| Enterovirus D68 isolate BCH895A, complete genome 9795 9795 100% 0.0 90% KF726085.1
Select seq dbj|AB601884.1| Human enterovirus 68 gene for polyprotein, complete cds, strain: JPOC10-396 9793 9793 94% 0.0 92% AB601884.1
Select seq gb|JX070222.1| Human enterovirus 68 isolate NZ-2010-541, complete genome 9725 9725 100% 0.0 90% JX070222.1
Select seq gb|KM851231.1| Enterovirus D68 strain US/KY/14-18953, complete genome 9582 9582 100% 0.0 90% KM851231.1
Select seq gb|KM361525.1| Enterovirus sp. isolate CU70 polyprotein gene, partial cds 9571 9571 98% 0.0 90% KM361525.1
Select seq gb|AY426531.1| Human enterovirus 68 strain Fermon, complete genome 8884 8884 100% 0.0 88% AY426531.1
Select seq gb|DQ916376.1| Human enterovirus 94 isolate E210, complete genome 4857 4857 99% 0.0 75% DQ916376.1
Select seq gb|EF107097.1| Human enterovirus 94 isolate 19/04 from Democratic Republic of the Congo, complete genome 4747 4747 99% 0.0 75% EF107097.1
Select seq gb|DQ201177.1| Human enterovirus 70 strain J670/71, complete genome 4291 4291 99% 0.0 74% DQ201177.1
Select seq dbj|D00820.1|EV70CG Human enterovirus 70 genomic RNA, complete genome, strain: J670/71 4278 4278 99% 0.0 74% D00820.1
Select seq gb|KC763162.1| Human enterovirus 68 strain ITA/20528/12 VP1 gene, partial cds 1552 1552 12% 0.0 97% KC763162.1
Select seq dbj|AB614427.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2035-Yamagata-2010 1463 1463 12% 0.0 95% AB614427.1
Select seq dbj|AB614430.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2082-Yamagata-2010 1454 1454 12% 0.0 95% AB614430.1
Select seq dbj|AB614431.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2145-Yamagata-2010 1454 1454 12% 0.0 95% AB614431.1
Select seq dbj|AB614409.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1975-Yamagata-2010 1454 1454 12% 0.0 95% AB614409.1
Select seq gb|JX101844.1| Human enterovirus 68 strain SA792 from South Africa polyprotein gene, 5' UTR and partial cds 1452 1452 12% 0.0 95% JX101844.1
Select seq gb|JX101843.1| Human enterovirus 68 strain SA563 from South Africa polyprotein gene, 5' UTR and partial cds 1452 1452 12% 0.0 95% JX101843.1
Select seq dbj|AB614433.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2086-Yamagata-2010 1449 1449 12% 0.0 95% AB614433.1
Select seq dbj|AB614437.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2161-Yamagata-2010 1445 1445 12% 0.0 95% AB614437.1
Select seq gb|JX101840.1| Human enterovirus 68 strain SA402 from South Africa polyprotein gene, 5' UTR and partial cds 1443 1443 12% 0.0 95% JX101840.1
Select seq gb|JX101841.1| Human enterovirus 68 strain SA498 from South Africa polyprotein gene, 5' UTR and partial cds 1442 1442 12% 0.0 95% JX101841.1
Select seq gb|KC763167.1| Human enterovirus 68 strain ITA/23695/12 VP1 gene, partial cds 1433 1433 12% 0.0 95% KC763167.1
Select seq gb|JX101842.1| Human enterovirus 68 strain SA551 from South Africa polyprotein gene, 5' UTR and partial cds 1433 1433 12% 0.0 95% JX101842.1
Select seq gb|KC763164.1| Human enterovirus 68 strain ITA/22516/12 VP1 gene, partial cds 1415 1415 12% 0.0 94% KC763164.1
Select seq gb|JX101799.1| Human enterovirus 68 strain SA563 from South Africa VP1 gene, partial cds 1413 1413 12% 0.0 94% JX101799.1
Select seq gb|AY426493.1| Human enterovirus 68 strain MO00 polyprotein gene, partial cds 1409 1409 12% 0.0 94% AY426493.1
Select seq gb|KC763169.1| Human enterovirus 68 strain ITA/24518/12 VP1 gene, partial cds 1406 1406 12% 0.0 94% KC763169.1
Select seq gb|AY426495.1| Human enterovirus 68 strain TX02-1 polyprotein gene, partial cds 1400 1400 12% 0.0 94% AY426495.1
Select seq gb|AY426494.1| Human enterovirus 68 strain WI00 polyprotein gene, partial cds 1400 1400 12% 0.0 94% AY426494.1
Select seq gb|JX101795.1| Human enterovirus 68 strain SA402 from South Africa VP1 gene, partial cds 1395 1395 12% 0.0 93% JX101795.1
Select seq gb|JX129472.1| Human enterovirus strain 68/Colombia/FLI6044/2010 polyprotein gene, partial cds 1384 1384 13% 0.0 91% JX129472.1
Select seq gb|JX129471.1| Human enterovirus strain 68/Colombia/FLI5997/2010 polyprotein gene, partial cds 1384 1384 13% 0.0 91% JX129471.1
Select seq gb|JX129470.1| Human enterovirus strain 68/Colombia/FLI5994/2010 polyprotein gene, partial cds 1371 1371 13% 0.0 91% JX129470.1
Select seq gb|KJ472886.1| Enterovirus D68 isolate HEV196011 VP1 gene, partial cds 1370 1370 12% 0.0 94% KJ472886.1
Select seq gb|AY426491.1| Human enterovirus 68 strain MD02-1 polyprotein gene, partial cds 1364 1364 12% 0.0 93% AY426491.1
Select seq gb|AY426492.1| Human enterovirus 68 strain MD02-2 polyprotein gene, partial cds 1359 1359 12% 0.0 93% AY426492.1
Select seq gb|AY426496.1| Human enterovirus 68 strain TX02-2 polyprotein gene, partial cds 1357 1357 12% 0.0 93% AY426496.1
Select seq dbj|AB667894.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2251-Yamagata-2005 1346 1346 12% 0.0 92% AB667894.1
Select seq dbj|AB667893.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2218-Yamagata-2005 1337 1337 12% 0.0 92% AB667893.1
Select seq dbj|AB667891.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2062-Yamagata-2005 1337 1337 12% 0.0 92% AB667891.1
Select seq gb|KC763157.1| Human enterovirus 68 strain ITA/18641/08 VP1 gene, partial cds 1333 1333 12% 0.0 92% KC763157.1
Select seq gb|JX101800.1| Human enterovirus 68 strain SA792 from South Africa VP1 gene, partial cds 1332 1332 12% 0.0 94% JX101800.1
Select seq dbj|AB667895.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1703-Yamagata-2007 1332 1332 12% 0.0 92% AB667895.1
Select seq dbj|AB667892.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2124-Yamagata-2005 1332 1332 12% 0.0 92% AB667892.1
Select seq dbj|AB614436.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2146-Yamagata-2010 1319 1319 12% 0.0 92% AB614436.1
Select seq dbj|AB614424.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2015-Yamagata-2010 1319 1319 12% 0.0 92% AB614424.1
Select seq dbj|AB614434.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2101-Yamagata-2010 1319 1319 12% 0.0 92% AB614434.1
Select seq dbj|AB614435.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2116-Yamagata-2010 1319 1319 12% 0.0 92% AB614435.1
Select seq gb|AY426497.1| Human enterovirus 68 strain MN98 polyprotein gene, partial cds 1319 1319 12% 0.0 92% AY426497.1
Select seq gb|KC763172.1| Human enterovirus 68 strain ITA/26868/08 VP1 gene, partial cds 1315 1315 12% 0.0 92% KC763172.1
Select seq gb|JX101797.1| Human enterovirus 68 strain SA551 from South Africa VP1 gene, partial cds 1314 1314 12% 0.0 91% JX101797.1
Select seq gb|JX101796.1| Human enterovirus 68 strain SA498 from South Africa VP1 gene, partial cds 1314 1314 12% 0.0 91% JX101796.1
Select seq gb|JX101834.1| Human enterovirus 68 strain SEN37 from Senegal polyprotein gene, 5' UTR and partial cds 1314 1314 12% 0.0 91% JX101834.1
Select seq gb|JX101833.1| Human enterovirus 68 strain SEN30 from Senegal polyprotein gene, 5' UTR and partial cds 1314 1314 12% 0.0 91% JX101833.1
Select seq gb|JX101818.1| Human enterovirus 68 strain NYC399 from USA polyprotein gene, 5' UTR and partial cds 1314 1314 12% 0.0 91% JX101818.1
Select seq gb|JX101817.1| Human enterovirus 68 strain NYC397 from USA polyprotein gene, 5' UTR and partial cds 1314 1314 12% 0.0 91% JX101817.1
Select seq dbj|AB601880.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-616 1314 1314 12% 0.0 91% AB601880.1
Select seq dbj|AB614438.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2166-Yamagata-2010 1314 1314 12% 0.0 91% AB614438.1
Select seq dbj|AB614411.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1980-Yamagata-2010 1314 1314 12% 0.0 91% AB614411.1
Select seq dbj|AB614412.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1981-Yamagata-2010 1314 1314 12% 0.0 91% AB614412.1
Select seq dbj|AB601881.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-618 1310 1310 12% 0.0 91% AB601881.1
Select seq dbj|AB601873.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-373 1310 1310 12% 0.0 91% AB601873.1
Select seq dbj|AB601874.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-402 1310 1310 12% 0.0 91% AB601874.1
Select seq dbj|AB601878.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-471 1310 1310 12% 0.0 91% AB601878.1
Select seq dbj|AB601872.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-200 1310 1310 12% 0.0 91% AB601872.1
Select seq dbj|AB614426.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2032-Yamagata-2010 1310 1310 12% 0.0 91% AB614426.1
Select seq dbj|AB614425.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2016-Yamagata-2010 1310 1310 12% 0.0 91% AB614425.1
Select seq dbj|AB614423.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2011-Yamagata-2010 1310 1310 12% 0.0 91% AB614423.1
Select seq dbj|AB614410.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1976-Yamagata-2010 1310 1310 12% 0.0 91% AB614410.1
Select seq dbj|AB614408.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1946-Yamagata-2010 1310 1310 12% 0.0 91% AB614408.1
Select seq dbj|AB614406.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1939-Yamagata-2010 1310 1310 12% 0.0 91% AB614406.1
Select seq dbj|AB614407.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2013-Yamagata-2010 1310 1310 12% 0.0 91% AB614407.1
Select seq gb|AY426499.1| Human enterovirus 68 strain MD99 polyprotein gene, partial cds 1310 1310 12% 0.0 91% AY426499.1
Select seq gb|JX101825.1| Human enterovirus 68 strain NYC458 from USA polyprotein gene, 5' UTR and partial cds 1308 1308 12% 0.0 91% JX101825.1
Select seq gb|KC763158.1| Human enterovirus 68 strain ITA/19179/08 VP1 gene, partial cds 1306 1306 12% 0.0 92% KC763158.1
Select seq dbj|AB601877.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-445 1306 1306 12% 0.0 91% AB601877.1
Select seq gb|JX101838.1| Human enterovirus 68 strain GA427 from Gambia polyprotein gene, 5' UTR and partial cds 1305 1305 12% 0.0 91% JX101838.1
Select seq gb|JX101823.1| Human enterovirus 68 strain NYC446 from USA polyprotein gene, 5' UTR and partial cds 1305 1305 12% 0.0 91% JX101823.1
Select seq dbj|AB601875.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-412 1305 1305 12% 0.0 91% AB601875.1
Select seq dbj|AB601879.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-573 1305 1305 12% 0.0 91% AB601879.1
Select seq dbj|AB614429.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2052-Yamagata-2010 1305 1305 12% 0.0 91% AB614429.1
Select seq gb|KC763173.1| Human enterovirus 68 strain ITA/27708/08 VP1 gene, partial cds 1303 1303 12% 0.0 91% KC763173.1
Select seq gb|JX101829.1| Human enterovirus 68 strain NYC567 from USA polyprotein gene, 5' UTR and partial cds 1303 1303 12% 0.0 91% JX101829.1
Select seq gb|JX101798.1| Human enterovirus 68 strain SA553 from South Africa VP1 gene, partial cds 1301 1301 12% 0.0 91% JX101798.1
Select seq gb|JX101786.1| Human enterovirus 68 strain ARI192 from USA VP1 gene, partial cds 1301 1301 12% 0.0 91% JX101786.1
Select seq dbj|AB614439.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2167-Yamagata-2010 1301 1301 12% 0.0 91% AB614439.1
Select seq dbj|AB614428.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2037-Yamagata-2010 1301 1301 12% 0.0 91% AB614428.1
Select seq gb|JX101837.1| Human enterovirus 68 strain GA424 from Gambia polyprotein gene, 5' UTR and partial cds 1299 1299 12% 0.0 91% JX101837.1
Select seq gb|JX101836.1| Human enterovirus 68 strain GA421 from Gambia polyprotein gene, 5' UTR and partial cds 1299 1299 12% 0.0 91% JX101836.1
Select seq gb|JX101835.1| Human enterovirus 68 strain GA420 from Gambia polyprotein gene, 5' UTR and partial cds 1299 1299 12% 0.0 91% JX101835.1
Select seq gb|JX101832.1| Human enterovirus 68 strain SEN3 from Senegal polyprotein gene, 5' UTR and partial cds 1299 1299 12% 0.0 91% JX101832.1
Select seq gb|JX101826.1| Human enterovirus 68 strain NYC465 from USA polyprotein gene, 5' UTR and partial cds 1299 1299 12% 0.0 91% JX101826.1
Select seq gb|KC763168.1| Human enterovirus 68 strain ITA/24281/08 VP1 gene, partial cds 1297 1297 12% 0.0 91% KC763168.1
Select seq gb|KC763171.1| Human enterovirus 68 strain ITA/26505/08 VP1 gene, partial cds 1297 1297 12% 0.0 91% KC763171.1
Select seq gb|KC763160.1| Human enterovirus 68 strain ITA/19962/08 VP1 gene, partial cds 1297 1297 12% 0.0 91% KC763160.1
Select seq dbj|AB601876.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-441 1297 1297 12% 0.0 91% AB601876.1
Select seq gb|JX101839.1| Human enterovirus 68 strain GA431 from Gambia polyprotein gene, 5' UTR and partial cds 1296 1296 12% 0.0 91% JX101839.1
Select seq gb|JX101816.1| Human enterovirus 68 strain NYC394 from USA polyprotein gene, 5' UTR and partial cds 1296 1296 12% 0.0 91% JX101816.1
Select seq gb|AY426498.1| Human enterovirus 68 strain TX99 polyprotein gene, partial cds 1292 1292 12% 0.0 91% AY426498.1
Select seq gb|AY426489.1| Human enterovirus 68 strain MN89 polyprotein gene, partial cds 1278 1278 12% 0.0 91% AY426489.1
Select seq gb|JX898785.1| Human enterovirus 68 isolate CQ5585 VP1 gene, partial cds 1274 1274 10% 0.0 97% JX898785.1
Select seq gb|JQ924867.1| Human enterovirus isolate CQ-5759 VP1 gene, partial cds 1274 1274 10% 0.0 97% JQ924867.1
Select seq gb|JQ924865.1| Human enterovirus isolate CQ-5584 VP1 gene, partial cds 1269 1269 10% 0.0 97% JQ924865.1
Select seq dbj|AB667896.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2311-Yamagata-2006 1263 1263 12% 0.0 90% AB667896.1
Select seq gb|JQ924866.1| Human enterovirus isolate CQ-5735 VP1 gene, partial cds 1251 1251 10% 0.0 97% JQ924866.1
Select seq gb|JQ411803.1| Human enterovirus D isolate TH_CU134 VP1 gene, partial cds 1249 1249 10% 0.0 97% JQ411803.1
Select seq gb|JQ411804.1| Human enterovirus D isolate TH_CU101 VP1 gene, partial cds 1249 1249 10% 0.0 97% JQ411804.1
Select seq gb|AY426500.1| Human enterovirus 68 strain TX03 polyprotein gene, partial cds 1249 1249 12% 0.0 90% AY426500.1
Select seq gb|JX129479.1| Human enterovirus strain 68/Peru/FPU00294/2011 polyprotein gene, partial cds 1242 1242 12% 0.0 91% JX129479.1
Select seq gb|JQ411807.1| Human enterovirus D isolate TH_CU124 VP1 gene, partial cds 1232 1232 10% 0.0 97% JQ411807.1
Select seq gb|AY426490.1| Human enterovirus 68 strain NY93 polyprotein gene, partial cds 1229 1229 12% 0.0 89% AY426490.1
Select seq dbj|AB667897.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2118-Yamagata-2007 1222 1222 12% 0.0 89% AB667897.1
Select seq dbj|AB667898.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1833-Yamagata-2008 1218 1218 12% 0.0 89% AB667898.1
Select seq gb|JX101801.1| Human enterovirus 68 strain SA726 from South Africa VP1 gene, partial cds 1214 1214 12% 0.0 91% JX101801.1
Select seq gb|JX101791.1| Human enterovirus 68 strain GA421 from Gambia VP1 gene, partial cds 1213 1213 12% 0.0 89% JX101791.1
Select seq gb|JX101789.1| Human enterovirus 68 strain SEN37 from Senegal VP1 gene, partial cds 1213 1213 12% 0.0 89% JX101789.1
Select seq gb|JX101788.1| Human enterovirus 68 strain SEN30 from Senegal VP1 gene, partial cds 1213 1213 12% 0.0 89% JX101788.1
Select seq gb|JX101807.1| Human enterovirus 68 strain NYC442 from USA VP1 gene, partial cds 1209 1209 12% 0.0 89% JX101807.1
Select seq gb|JX101805.1| Human enterovirus 68 strain NYC399 from USA VP1 gene, partial cds 1209 1209 12% 0.0 89% JX101805.1
Select seq gb|JX101792.1| Human enterovirus 68 strain GA424 from Gambia VP1 gene, partial cds 1209 1209 12% 0.0 89% JX101792.1
Select seq gb|JX101790.1| Human enterovirus 68 strain GA420 from Gambia VP1 gene, partial cds 1209 1209 12% 0.0 89% JX101790.1
Select seq gb|KF254918.1| Enterovirus D68 isolate SO9493 VP1 gene, partial cds 1205 1205 10% 0.0 95% KF254918.1
Select seq gb|JX101812.1| Human enterovirus 68 strain NYC496 from USA VP1 gene, partial cds 1204 1204 12% 0.0 89% JX101812.1
Select seq gb|JX101806.1| Human enterovirus 68 strain NYC403 from USA VP1 gene, partial cds 1204 1204 12% 0.0 89% JX101806.1
Select seq gb|JX101794.1| Human enterovirus 68 strain GA431 from Gambia VP1 gene, partial cds 1204 1204 12% 0.0 89% JX101794.1
Select seq dbj|AB667899.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1737-Yamagata-2008 1204 1204 12% 0.0 89% AB667899.1
Select seq gb|KF254921.1| Enterovirus D68 isolate SO9411 VP1 gene, partial cds 1202 1202 10% 0.0 95% KF254921.1
Select seq gb|KC763161.1| Human enterovirus 68 strain ITA/20260/08 VP1 gene, partial cds 1202 1202 12% 0.0 89% KC763161.1
Select seq gb|KF254923.1| Enterovirus D68 isolate SO9306 VP1 gene, partial cds 1200 1200 10% 0.0 94% KF254923.1
Select seq gb|JX101810.1| Human enterovirus 68 strain NYC458 from USA VP1 gene, partial cds 1200 1200 12% 0.0 89% JX101810.1
Select seq gb|KF254920.1| Enterovirus D68 isolate SO9277 VP1 gene, partial cds 1198 1198 10% 0.0 94% KF254920.1
Select seq gb|KF254919.1| Enterovirus D68 isolate SO9320 VP1 gene, partial cds 1198 1198 10% 0.0 94% KF254919.1
Select seq gb|KF254917.1| Enterovirus D68 isolate SO9336 VP1 gene, partial cds 1196 1196 10% 0.0 94% KF254917.1
Select seq gb|KC763176.1| Human enterovirus 68 strain ITA/33707/10 VP1 gene, partial cds 1193 1193 12% 0.0 89% KC763176.1
Select seq gb|KC763175.1| Human enterovirus 68 strain ITA/33658/10 VP1 gene, partial cds 1193 1193 12% 0.0 89% KC763175.1
Select seq gb|KC763163.1| Human enterovirus 68 strain ITA/22289/08 VP1 gene, partial cds 1193 1193 12% 0.0 89% KC763163.1
Select seq gb|KC763165.1| Human enterovirus 68 strain ITA/22719/08 VP1 gene, partial cds 1193 1193 12% 0.0 89% KC763165.1
Select seq gb|KC763166.1| Human enterovirus 68 strain ITA/23352/08 VP1 gene, partial cds 1193 1193 12% 0.0 89% KC763166.1
Select seq gb|KF254924.1| Enterovirus D68 isolate SO9406 VP1 gene, partial cds 1191 1191 10% 0.0 95% KF254924.1
Select seq gb|JX101804.1| Human enterovirus 68 strain NYC394 from USA VP1 gene, partial cds 1191 1191 12% 0.0 89% JX101804.1
Select seq dbj|AB614441.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2093-Yamagata-2010 1191 1191 12% 0.0 89% AB614441.1
Select seq gb|KC763170.1| Human enterovirus 68 strain ITA/26423/08 VP1 gene, partial cds 1187 1187 12% 0.0 89% KC763170.1
Select seq gb|JX101814.1| Human enterovirus 68 strain NYC817 from USA VP1 gene, partial cds 1186 1186 12% 0.0 88% JX101814.1
Select seq gb|JX101811.1| Human enterovirus 68 strain NYC465 from USA VP1 gene, partial cds 1186 1186 12% 0.0 88% JX101811.1
Select seq gb|JX101787.1| Human enterovirus 68 strain SEN03 from Senegal VP1 gene, partial cds 1186 1186 12% 0.0 88% JX101787.1
Select seq gb|KF254913.1| Enterovirus D68 isolate ID72 VP1 gene, partial cds 1184 1184 10% 0.0 94% KF254913.1
Select seq gb|KF254922.1| Enterovirus D68 isolate SO9288 VP1 gene, partial cds 1182 1182 10% 0.0 94% KF254922.1
Select seq gb|JX101809.1| Human enterovirus 68 strain NYC435 from USA VP1 gene, partial cds 1182 1182 12% 0.0 88% JX101809.1
Select seq gb|JX101808.1| Human enterovirus 68 strain NYC409 from USA VP1 gene, partial cds 1182 1182 12% 0.0 88% JX101808.1
Select seq gb|JX101803.1| Human enterovirus 68 strain NYC369 from USA VP1 gene, partial cds 1182 1182 12% 0.0 88% JX101803.1
Select seq dbj|AB614442.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2174-Yamagata-2010 1182 1182 12% 0.0 88% AB614442.1
Select seq dbj|AB614440.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2076-Yamagata-2010 1182 1182 12% 0.0 88% AB614440.1
Select seq gb|KC763177.1| Human enterovirus 68 strain ITA/34800/10 VP1 gene, partial cds 1178 1178 12% 0.0 89% KC763177.1
Select seq gb|KC763174.1| Human enterovirus 68 strain ITA/31742/10 VP1 gene, partial cds 1178 1178 12% 0.0 89% KC763174.1
Select seq gb|JX101813.1| Human enterovirus 68 strain NYC567 from USA VP1 gene, partial cds 1177 1177 12% 0.0 88% JX101813.1
Select seq dbj|AB614443.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2256-Yamagata-2010 1177 1177 12% 0.0 88% AB614443.1
Select seq dbj|AB614444.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2336-Yamagata-2010 1177 1177 12% 0.0 88% AB614444.1
Select seq gb|KC763159.1| Human enterovirus 68 strain ITA/19391/12 VP1 gene, partial cds 1175 1175 12% 0.0 88% KC763159.1
Select seq gb|KJ472885.1| Enterovirus D68 isolate HEV137010 VP1 gene, partial cds 1168 1168 12% 0.0 88% KJ472885.1
Select seq gb|JF896311.1| Human enterovirus 68 isolate EV68_NL_200912598 VP1 protein gene, partial cds 1164 1164 10% 0.0 95% JF896311.1
Select seq gb|JF896308.1| Human enterovirus 68 isolate EV68_NL_200913563 VP1 protein gene, partial cds 1162 1162 10% 0.0 95% JF896308.1
Select seq gb|JF896309.1| Human enterovirus 68 isolate EV68_NL_200914986 VP1 protein gene, partial cds 1162 1162 10% 0.0 95% JF896309.1
Select seq gb|JF896306.1| Human enterovirus 68 isolate EV68_NL_201013230 VP1 protein gene, partial cds 1157 1157 10% 0.0 95% JF896306.1
Select seq gb|AY426487.1| Human enterovirus 68 strain CA62-2 polyprotein gene, partial cds 1157 1157 12% 0.0 88% AY426487.1
Select seq gb|AY426486.1| Human enterovirus 68 strain CA62-1 polyprotein gene, partial cds 1157 1157 12% 0.0 88% AY426486.1
Select seq gb|KJ472880.1| Enterovirus D68 isolate HEV085008 VP1 gene, partial cds 1155 1155 12% 0.0 89% KJ472880.1
Select seq gb|KJ472878.1| Enterovirus D68 isolate HEV044008 VP1 gene, partial cds 1153 1153 12% 0.0 88% KJ472878.1
Select seq gb|JX101802.1| Human enterovirus 68 strain SA1354 from South Africa VP1 gene, partial cds 1153 1153 11% 0.0 90% JX101802.1
Select seq gb|JF896310.1| Human enterovirus 68 isolate EV68_NL_200914918 VP1 protein gene, partial cds 1153 1153 10% 0.0 95% JF896310.1
Select seq gb|JF896307.1| Human enterovirus 68 isolate EV68_NL_201012867 VP1 protein gene, partial cds 1153 1153 10% 0.0 95% JF896307.1
Select seq gb|JF896305.1| Human enterovirus 68 isolate EV68_NL_201014073 VP1 protein gene, partial cds 1153 1153 10% 0.0 95% JF896305.1
Select seq gb|KJ472884.1| Enterovirus D68 isolate HEV126010 VP1 gene, partial cds 1151 1151 12% 0.0 89% KJ472884.1
Select seq dbj|AB902837.1| Enterovirus D68 gene for polyprotein, partial cds, strain: EV68/Okinawa/174/2010 1151 1151 10% 0.0 96% AB902837.1
Select seq gb|JF896302.1| Human enterovirus 68 isolate EV68_NL_201013557 VP1 protein gene, partial cds 1148 1148 10% 0.0 94% JF896302.1
Select seq gb|JF896303.1| Human enterovirus 68 isolate EV68_NL_201012467 VP1 protein gene, partial cds 1148 1148 10% 0.0 94% JF896303.1
Select seq gb|JX402054.1| Human enterovirus 68 isolate 91013136 polyprotein gene, partial cds 1141 1141 9% 0.0 97% JX402054.1
Select seq gb|JF896304.1| Human enterovirus 68 isolate EV68_NL_201011595 VP1 protein gene, partial cds 1139 1139 10% 0.0 94% JF896304.1
Select seq gb|AY426488.1| Human enterovirus 68 strain CA62-3 polyprotein gene, partial cds 1139 1139 12% 0.0 87% AY426488.1
Select seq gb|KJ472883.1| Enterovirus D68 isolate HEV124010 VP1 gene, partial cds 1133 1133 12% 0.0 88% KJ472883.1
Select seq gb|AF081348.1| Enterovirus 68 strain Fermon capsid protein VP1 (VP1) gene, partial cds 1128 1128 13% 0.0 87% AF081348.1
Select seq gb|JX402057.1| Human enterovirus 68 isolate 91106975 polyprotein gene, partial cds 1124 1124 9% 0.0 97% JX402057.1
Select seq gb|AY355268.1| Human rhinovirus 87 VP1 capsid protein gene, partial cds 1124 1124 13% 0.0 87% AY355268.1
Select seq gb|JX402052.1| Human enterovirus 68 isolate 91003100 polyprotein gene, partial cds 1122 1122 9% 0.0 97% JX402052.1
Select seq gb|JX402053.1| Human enterovirus 68 isolate 91005422 polyprotein gene, partial cds 1122 1122 9% 0.0 97% JX402053.1
Select seq gb|JX402056.1| Human enterovirus 68 isolate 91110530 polyprotein gene, partial cds 1117 1117 9% 0.0 97% JX402056.1
Select seq gb|JX402055.1| Human enterovirus 68 isolate 91105967 polyprotein gene, partial cds 1117 1117 9% 0.0 97% JX402055.1
Select seq gb|JX402051.1| Human enterovirus 68 isolate 91006756 polyprotein gene, partial cds 1117 1117 9% 0.0 97% JX402051.1
Select seq gb|JX402060.1| Human enterovirus 68 isolate 91006265 polyprotein gene, partial cds 1113 1113 9% 0.0 97% JX402060.1
Select seq gb|KJ472882.1| Enterovirus D68 isolate HEV156010 VP1 gene, partial cds 1074 1074 12% 0.0 87% KJ472882.1
Select seq gb|JX402058.1| Human enterovirus 68 isolate 90905081 polyprotein gene, partial cds 1012 1012 8% 0.0 97% JX402058.1
Select seq gb|JQ713912.1| Human enterovirus 68 isolate NZ-2010-541 VP1 protein gene, partial cds 984 984 11% 0.0 88% JQ713912.1
Select seq gb|JQ713911.1| Human enterovirus 68 isolate NZ-2010-539 VP1 protein gene, partial cds 984 984 11% 0.0 88% JQ713911.1
Select seq gb|JQ713904.1| Human enterovirus 68 isolate NZ-2010-1507 VP1 protein gene, partial cds 980 980 10% 0.0 88% JQ713904.1
Select seq gb|JQ713909.1| Human enterovirus 68 isolate NZ-2010-435 VP1 protein gene, partial cds 975 975 10% 0.0 88% JQ713909.1
Select seq gb|JQ713906.1| Human enterovirus 68 isolate NZ-2010-358 VP1 protein gene, partial cds 971 971 10% 0.0 88% JQ713906.1
Select seq gb|JQ713905.1| Human enterovirus 68 isolate NZ-2010-183 VP1 protein gene, partial cds 971 971 10% 0.0 88% JQ713905.1
Select seq gb|JQ586222.1| Human enterovirus 68, VP1, partial sequence, 09-85 971 971 8% 0.0 95% JQ586222.1
Select seq gb|JQ713907.1| Human enterovirus 68 isolate NZ-2010-404 VP1 protein gene, partial cds 964 964 10% 0.0 88% JQ713907.1
Select seq gb|JQ713910.1| Human enterovirus 68 isolate NZ-2010-481 VP1 protein gene, partial cds 962 962 10% 0.0 88% JQ713910.1
Select seq gb|KF254915.1| Enterovirus D68 isolate SO9749 VP1 gene, partial cds 957 957 10% 0.0 88% KF254915.1
Select seq gb|JQ586223.1| Human enterovirus 68, VP1, partial sequence, 09-86 953 953 8% 0.0 95% JQ586223.1
Select seq gb|JQ924862.1| Human enterovirus isolate TJ-3395 VP1 gene, partial cds 951 951 10% 0.0 88% JQ924862.1
Select seq gb|JQ586224.1| Human enterovirus 68, VP1, partial sequence, 09-115 951 951 8% 0.0 95% JQ586224.1
Select seq gb|JQ924863.1| Human enterovirus isolate CQ-3578 VP1 gene, partial cds 949 949 10% 0.0 88% JQ924863.1
Select seq gb|JQ586226.1| Human enterovirus 68, VP1, partial sequence, 09-398 948 948 8% 0.0 95% JQ586226.1
Select seq gb|JQ411802.1| Human enterovirus D isolate TH_B1512 VP1 gene, partial cds 946 946 10% 0.0 88% JQ411802.1
Select seq gb|KF254914.1| Enterovirus D68 isolate SO9770 VP1 gene, partial cds 944 944 10% 0.0 87% KF254914.1
Select seq gb|JQ586221.1| Human enterovirus 68, VP1, partial sequence, 09-56 944 944 8% 0.0 95% JQ586221.1
Select seq gb|JF896290.1| Human enterovirus 68 isolate EV68_NL_201012910 VP1 protein gene, partial cds 944 944 10% 0.0 88% JF896290.1
Select seq gb|JX898784.1| Human enterovirus 68 isolate CQ4278 VP1 gene, partial cds 942 942 10% 0.0 88% JX898784.1
Select seq dbj|AB817708.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph597_VP1 939 939 8% 0.0 95% AB817708.1
Select seq dbj|AB817706.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph560_VP1 939 939 8% 0.0 95% AB817706.1
Select seq dbj|AB817705.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph519_VP1 939 939 8% 0.0 95% AB817705.1
Select seq dbj|AB817704.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph513_VP1 939 939 8% 0.0 95% AB817704.1
Select seq dbj|AB817702.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph343_VP1 939 939 8% 0.0 95% AB817702.1
Select seq gb|JF896300.1| Human enterovirus 68 isolate EV68_NL_201012472 VP1 protein gene, partial cds 939 939 10% 0.0 88% JF896300.1
Select seq gb|JF896295.1| Human enterovirus 68 isolate EV68_NL_201012756 VP1 protein gene, partial cds 939 939 10% 0.0 88% JF896295.1
Select seq gb|JF896294.1| Human enterovirus 68 isolate EV68_NL_201012721 VP1 protein gene, partial cds 939 939 10% 0.0 88% JF896294.1
Select seq gb|JF896289.1| Human enterovirus 68 isolate EV68_NL_201013352 VP1 protein gene, partial cds 939 939 10% 0.0 88% JF896289.1
Select seq gb|JQ586241.1| Human enterovirus 68 strain 09-398 polyprotein gene, partial cds 937 937 8% 0.0 96% JQ586241.1
Select seq gb|JQ586237.1| Human enterovirus 68 strain 09-56 polyprotein gene, partial cds 937 937 8% 0.0 96% JQ586237.1
Select seq dbj|AB817709.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph608_VP1 935 935 8% 0.0 95% AB817709.1
Select seq gb|JF896299.1| Human enterovirus 68 isolate EV68_NL_201012584 VP1 protein gene, partial cds 935 935 10% 0.0 88% JF896299.1
Select seq gb|JF896291.1| Human enterovirus 68 isolate EV68_NL_201012462 VP1 protein gene, partial cds 935 935 10% 0.0 88% JF896291.1
Select seq gb|JQ586242.1| Human enterovirus 68 strain 09-400 polyprotein gene, partial cds 933 933 8% 0.0 96% JQ586242.1
Select seq gb|JF896298.1| Human enterovirus 68 isolate EV68_NL_201012233 VP1 protein gene, partial cds 931 931 10% 0.0 88% JF896298.1
Select seq dbj|AB817703.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph451_VP1 930 930 8% 0.0 95% AB817703.1
Select seq gb|JF896297.1| Human enterovirus 68 isolate EV68_NL_201011288 VP1 protein gene, partial cds 930 930 10% 0.0 88% JF896297.1
Select seq gb|JF896293.1| Human enterovirus 68 isolate EV68_NL_201012159 VP1 protein gene, partial cds 930 930 10% 0.0 88% JF896293.1
Select seq gb|JF896292.1| Human enterovirus 68 isolate EV68_NL_201014502 VP1 protein gene, partial cds 930 930 10% 0.0 88% JF896292.1
Select seq gb|JQ586238.1| Human enterovirus 68 strain 09-85 polyprotein gene, partial cds 928 928 8% 0.0 96% JQ586238.1
Select seq gb|JF896312.1| Human enterovirus 68 isolate EV68_NL_201013421 VP1 protein gene, partial cds 926 926 10% 0.0 88% JF896312.1
Select seq gb|JF896296.1| Human enterovirus 68 isolate EV68_NL_201012463 VP1 protein gene, partial cds 926 926 10% 0.0 88% JF896296.1
Select seq gb|JQ586239.1| Human enterovirus 68 strain 09-86 polyprotein gene, partial cds 924 924 8% 0.0 96% JQ586239.1
Select seq gb|JQ411811.1| Human enterovirus D isolate TH_CU115 VP1 gene, partial cds 921 921 10% 0.0 88% JQ411811.1
Select seq gb|JQ411806.1| Human enterovirus D isolate TH_CU151 VP1 gene, partial cds 921 921 10% 0.0 88% JQ411806.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Oct 13, 2014 10:49 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
VP1 matches
Select seq gb|KM881710.1| Enterovirus D68 strain EV-D68_STL_2014_12, complete genome 1629 1629 100% 0.0 100% KM881710.1
Select seq gb|KM851225.1| Enterovirus D68 strain US/MO/14-18947, complete genome 1602 1602 100% 0.0 99% KM851225.1
Select seq gb|KM851228.1| Enterovirus D68 strain US/MO/14-18950, complete genome 1593 1593 100% 0.0 99% KM851228.1
Select seq gb|KM851226.1| Enterovirus D68 strain US/MO/14-18948, complete genome 1584 1584 100% 0.0 99% KM851226.1
Select seq gb|KM851227.1| Enterovirus D68 strain US/MO/14-18949, complete genome 1575 1575 100% 0.0 99% KM851227.1
Select seq gb|KC763162.1| Human enterovirus 68 strain ITA/20528/12 VP1 gene, partial cds 1519 1519 99% 0.0 97% KC763162.1
Select seq gb|KM361523.1| Enterovirus sp. isolate CU134 polyprotein gene, partial cds 1512 1512 100% 0.0 97% KM361523.1
Select seq gb|KM361524.1| Enterovirus sp. isolate CU171 polyprotein gene, partial cds 1507 1507 100% 0.0 97% KM361524.1
Select seq dbj|AB614427.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2035-Yamagata-2010 1431 1431 100% 0.0 95% AB614427.1
Select seq dbj|AB614430.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2082-Yamagata-2010 1422 1422 100% 0.0 95% AB614430.1
Select seq dbj|AB614431.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2145-Yamagata-2010 1422 1422 100% 0.0 95% AB614431.1
Select seq dbj|AB614433.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2086-Yamagata-2010 1416 1416 100% 0.0 95% AB614433.1
Select seq dbj|AB614409.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1975-Yamagata-2010 1416 1416 100% 0.0 95% AB614409.1
Select seq dbj|AB614437.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2161-Yamagata-2010 1413 1413 100% 0.0 95% AB614437.1
Select seq gb|KC763167.1| Human enterovirus 68 strain ITA/23695/12 VP1 gene, partial cds 1407 1407 99% 0.0 95% KC763167.1
Select seq gb|KM851230.1| Enterovirus D68 strain US/IL/14-18952, complete genome 1398 1398 100% 0.0 94% KM851230.1
Select seq gb|KM851229.1| Enterovirus D68 strain US/KY/14-18951, complete genome 1398 1398 100% 0.0 94% KM851229.1
Select seq gb|KC763164.1| Human enterovirus 68 strain ITA/22516/12 VP1 gene, partial cds 1393 1393 99% 0.0 94% KC763164.1
Select seq gb|KC763169.1| Human enterovirus 68 strain ITA/24518/12 VP1 gene, partial cds 1384 1384 99% 0.0 94% KC763169.1
Select seq gb|JX101799.1| Human enterovirus 68 strain SA563 from South Africa VP1 gene, partial cds 1380 1380 100% 0.0 94% JX101799.1
Select seq gb|AY426493.1| Human enterovirus 68 strain MO00 polyprotein gene, partial cds 1380 1380 100% 0.0 94% AY426493.1
Select seq gb|AY426494.1| Human enterovirus 68 strain WI00 polyprotein gene, partial cds 1377 1377 100% 0.0 94% AY426494.1
Select seq gb|AY426495.1| Human enterovirus 68 strain TX02-1 polyprotein gene, partial cds 1371 1371 100% 0.0 94% AY426495.1
Select seq gb|KJ472886.1| Enterovirus D68 isolate HEV196011 VP1 gene, partial cds 1370 1370 99% 0.0 94% KJ472886.1
Select seq gb|JX101795.1| Human enterovirus 68 strain SA402 from South Africa VP1 gene, partial cds 1368 1368 100% 0.0 94% JX101795.1
Select seq gb|AY426496.1| Human enterovirus 68 strain TX02-2 polyprotein gene, partial cds 1335 1335 100% 0.0 93% AY426496.1
Select seq gb|AY426491.1| Human enterovirus 68 strain MD02-1 polyprotein gene, partial cds 1335 1335 100% 0.0 93% AY426491.1
Select seq gb|AY426492.1| Human enterovirus 68 strain MD02-2 polyprotein gene, partial cds 1332 1332 100% 0.0 93% AY426492.1
Select seq dbj|AB667894.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2251-Yamagata-2005 1321 1321 99% 0.0 92% AB667894.1
Select seq dbj|AB667893.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2218-Yamagata-2005 1315 1315 99% 0.0 92% AB667893.1
Select seq gb|KC763157.1| Human enterovirus 68 strain ITA/18641/08 VP1 gene, partial cds 1312 1312 99% 0.0 92% KC763157.1
Select seq dbj|AB667891.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2062-Yamagata-2005 1312 1312 99% 0.0 92% AB667891.1
Select seq gb|JX101800.1| Human enterovirus 68 strain SA792 from South Africa VP1 gene, partial cds 1306 1306 94% 0.0 94% JX101800.1
Select seq dbj|AB667895.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1703-Yamagata-2007 1306 1306 99% 0.0 92% AB667895.1
Select seq dbj|AB667892.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2124-Yamagata-2005 1306 1306 99% 0.0 92% AB667892.1
Select seq gb|KC763172.1| Human enterovirus 68 strain ITA/26868/08 VP1 gene, partial cds 1294 1294 99% 0.0 92% KC763172.1
Select seq dbj|AB614424.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2015-Yamagata-2010 1294 1294 99% 0.0 92% AB614424.1
Select seq dbj|AB614434.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2101-Yamagata-2010 1294 1294 99% 0.0 92% AB614434.1
Select seq dbj|AB614435.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2116-Yamagata-2010 1294 1294 99% 0.0 92% AB614435.1
Select seq dbj|AB614436.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2146-Yamagata-2010 1290 1290 100% 0.0 92% AB614436.1
Select seq gb|AY426497.1| Human enterovirus 68 strain MN98 polyprotein gene, partial cds 1290 1290 100% 0.0 92% AY426497.1
Select seq dbj|AB601880.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-616 1288 1288 99% 0.0 92% AB601880.1
Select seq dbj|AB614438.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2166-Yamagata-2010 1288 1288 99% 0.0 92% AB614438.1
Select seq dbj|AB614411.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1980-Yamagata-2010 1288 1288 99% 0.0 92% AB614411.1
Select seq dbj|AB614412.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1981-Yamagata-2010 1288 1288 99% 0.0 92% AB614412.1
Select seq dbj|AB601883.2| Human enterovirus 68 genomic RNA, complete genome, strain: JPOC10-378 1285 1285 99% 0.0 92% AB601883.2
Select seq dbj|AB601885.1| Human enterovirus 68 gene for polyprotein, complete cds, strain: JPOC10-404 1285 1285 99% 0.0 92% AB601885.1
Select seq dbj|AB601881.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-618 1285 1285 99% 0.0 92% AB601881.1
Select seq dbj|AB601873.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-373 1285 1285 99% 0.0 92% AB601873.1
Select seq dbj|AB601877.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-445 1285 1285 99% 0.0 92% AB601877.1
Select seq dbj|AB601874.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-402 1285 1285 99% 0.0 92% AB601874.1
Select seq dbj|AB601878.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-471 1285 1285 99% 0.0 92% AB601878.1
Select seq dbj|AB601872.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-200 1285 1285 99% 0.0 92% AB601872.1
Select seq dbj|AB614426.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2032-Yamagata-2010 1285 1285 99% 0.0 92% AB614426.1
Select seq dbj|AB614425.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2016-Yamagata-2010 1285 1285 99% 0.0 92% AB614425.1
Select seq dbj|AB614423.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2011-Yamagata-2010 1285 1285 99% 0.0 92% AB614423.1
Select seq dbj|AB614410.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1976-Yamagata-2010 1285 1285 99% 0.0 92% AB614410.1
Select seq dbj|AB614408.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1946-Yamagata-2010 1285 1285 99% 0.0 92% AB614408.1
Select seq dbj|AB614406.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 1939-Yamagata-2010 1285 1285 99% 0.0 92% AB614406.1
Select seq dbj|AB614407.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2013-Yamagata-2010 1285 1285 99% 0.0 92% AB614407.1
Select seq gb|KC763173.1| Human enterovirus 68 strain ITA/27708/08 VP1 gene, partial cds 1281 1281 99% 0.0 92% KC763173.1
Select seq gb|KC763158.1| Human enterovirus 68 strain ITA/19179/08 VP1 gene, partial cds 1281 1281 99% 0.0 92% KC763158.1
Select seq gb|JX101797.1| Human enterovirus 68 strain SA551 from South Africa VP1 gene, partial cds 1281 1281 100% 0.0 91% JX101797.1
Select seq gb|JX101796.1| Human enterovirus 68 strain SA498 from South Africa VP1 gene, partial cds 1281 1281 100% 0.0 91% JX101796.1
Select seq dbj|AB601884.1| Human enterovirus 68 gene for polyprotein, complete cds, strain: JPOC10-396 1279 1279 99% 0.0 91% AB601884.1
Select seq dbj|AB601875.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-412 1279 1279 99% 0.0 91% AB601875.1
Select seq dbj|AB601879.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-573 1279 1279 99% 0.0 91% AB601879.1
Select seq dbj|AB614429.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2052-Yamagata-2010 1279 1279 99% 0.0 91% AB614429.1
Select seq gb|AY426499.1| Human enterovirus 68 strain MD99 polyprotein gene, partial cds 1278 1278 100% 0.0 91% AY426499.1
Select seq gb|KC763168.1| Human enterovirus 68 strain ITA/24281/08 VP1 gene, partial cds 1276 1276 99% 0.0 91% KC763168.1
Select seq gb|KC763171.1| Human enterovirus 68 strain ITA/26505/08 VP1 gene, partial cds 1276 1276 99% 0.0 91% KC763171.1
Select seq gb|KC763160.1| Human enterovirus 68 strain ITA/19962/08 VP1 gene, partial cds 1276 1276 99% 0.0 91% KC763160.1
Select seq gb|JX101786.1| Human enterovirus 68 strain ARI192 from USA VP1 gene, partial cds 1276 1276 99% 0.0 91% JX101786.1
Select seq dbj|AB601876.1| Human enterovirus 68 gene for polyprotein, partial cds, VP1 protein region, strain: JPOC10-441 1276 1276 99% 0.0 91% AB601876.1
Select seq dbj|AB614439.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2167-Yamagata-2010 1276 1276 99% 0.0 91% AB614439.1
Select seq dbj|AB614428.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2037-Yamagata-2010 1276 1276 99% 0.0 91% AB614428.1
Select seq gb|EF107098.1| Human enterovirus 68 isolate 37-99 from France, complete genome 1272 1272 100% 0.0 91% EF107098.1
Select seq gb|JX101798.1| Human enterovirus 68 strain SA553 from South Africa VP1 gene, partial cds 1270 1270 99% 0.0 91% JX101798.1
Select seq dbj|AB601882.2| Human enterovirus 68 genomic RNA, complete genome, strain: JPOC10-290 1261 1261 99% 0.0 91% AB601882.2
Select seq gb|AY426498.1| Human enterovirus 68 strain TX99 polyprotein gene, partial cds 1260 1260 100% 0.0 91% AY426498.1
Select seq gb|AY426489.1| Human enterovirus 68 strain MN89 polyprotein gene, partial cds 1252 1252 99% 0.0 91% AY426489.1
Select seq gb|JX898785.1| Human enterovirus 68 isolate CQ5585 VP1 gene, partial cds 1242 1242 81% 0.0 97% JX898785.1
Select seq gb|JQ924867.1| Human enterovirus isolate CQ-5759 VP1 gene, partial cds 1242 1242 81% 0.0 97% JQ924867.1
Select seq gb|JQ924865.1| Human enterovirus isolate CQ-5584 VP1 gene, partial cds 1236 1236 81% 0.0 97% JQ924865.1
Select seq dbj|AB667896.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2311-Yamagata-2006 1234 1234 100% 0.0 90% AB667896.1
Select seq gb|AY426500.1| Human enterovirus 68 strain TX03 polyprotein gene, partial cds 1222 1222 100% 0.0 90% AY426500.1
Select seq gb|JQ924866.1| Human enterovirus isolate CQ-5735 VP1 gene, partial cds 1218 1218 81% 0.0 97% JQ924866.1
Select seq gb|JQ411803.1| Human enterovirus D isolate TH_CU134 VP1 gene, partial cds 1216 1216 80% 0.0 97% JQ411803.1
Select seq gb|JQ411804.1| Human enterovirus D isolate TH_CU101 VP1 gene, partial cds 1216 1216 80% 0.0 97% JQ411804.1
Select seq gb|AY426490.1| Human enterovirus 68 strain NY93 polyprotein gene, partial cds 1204 1204 99% 0.0 90% AY426490.1
Select seq gb|JQ411807.1| Human enterovirus D isolate TH_CU124 VP1 gene, partial cds 1200 1200 79% 0.0 97% JQ411807.1
Select seq gb|JX101789.1| Human enterovirus 68 strain SEN37 from Senegal VP1 gene, partial cds 1195 1195 100% 0.0 89% JX101789.1
Select seq gb|JX101788.1| Human enterovirus 68 strain SEN30 from Senegal VP1 gene, partial cds 1195 1195 100% 0.0 89% JX101788.1
Select seq gb|JX101801.1| Human enterovirus 68 strain SA726 from South Africa VP1 gene, partial cds 1189 1189 94% 0.0 91% JX101801.1
Select seq dbj|AB667897.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 2118-Yamagata-2007 1189 1189 100% 0.0 89% AB667897.1
Select seq gb|KM361525.1| Enterovirus sp. isolate CU70 polyprotein gene, partial cds 1186 1186 100% 0.0 89% KM361525.1
Select seq gb|JX101807.1| Human enterovirus 68 strain NYC442 from USA VP1 gene, partial cds 1186 1186 100% 0.0 89% JX101807.1
Select seq gb|JX101805.1| Human enterovirus 68 strain NYC399 from USA VP1 gene, partial cds 1186 1186 100% 0.0 89% JX101805.1
Select seq dbj|AB667898.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1833-Yamagata-2008 1186 1186 100% 0.0 89% AB667898.1
Select seq gb|KC763161.1| Human enterovirus 68 strain ITA/20260/08 VP1 gene, partial cds 1184 1184 99% 0.0 89% KC763161.1
Select seq dbj|AB667899.1| Human enterovirus 68 VP1 gene for polyprotein, partial cds, strain: 1737-Yamagata-2008 1182 1182 99% 0.0 89% AB667899.1
Select seq gb|JX101846.1| Human enterovirus 68 strain NYC403 from USA, complete genome 1180 1180 100% 0.0 89% JX101846.1
Select seq gb|JX101812.1| Human enterovirus 68 strain NYC496 from USA VP1 gene, partial cds 1180 1180 100% 0.0 89% JX101812.1
Select seq gb|JX101806.1| Human enterovirus 68 strain NYC403 from USA VP1 gene, partial cds 1180 1180 100% 0.0 89% JX101806.1
Select seq gb|JX101791.1| Human enterovirus 68 strain GA421 from Gambia VP1 gene, partial cds 1180 1180 100% 0.0 89% JX101791.1
Select seq gb|KF254918.1| Enterovirus D68 isolate SO9493 VP1 gene, partial cds 1178 1178 83% 0.0 95% KF254918.1
Select seq gb|JX101792.1| Human enterovirus 68 strain GA424 from Gambia VP1 gene, partial cds 1177 1177 100% 0.0 89% JX101792.1
Select seq gb|JX101790.1| Human enterovirus 68 strain GA420 from Gambia VP1 gene, partial cds 1177 1177 100% 0.0 89% JX101790.1
Select seq gb|KF254921.1| Enterovirus D68 isolate SO9411 VP1 gene, partial cds 1175 1175 83% 0.0 95% KF254921.1
Select seq gb|KC763176.1| Human enterovirus 68 strain ITA/33707/10 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763176.1
Select seq gb|KC763175.1| Human enterovirus 68 strain ITA/33658/10 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763175.1
Select seq gb|KC763170.1| Human enterovirus 68 strain ITA/26423/08 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763170.1
Select seq gb|KC763163.1| Human enterovirus 68 strain ITA/22289/08 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763163.1
Select seq gb|KC763165.1| Human enterovirus 68 strain ITA/22719/08 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763165.1
Select seq gb|KC763166.1| Human enterovirus 68 strain ITA/23352/08 VP1 gene, partial cds 1175 1175 99% 0.0 89% KC763166.1
Select seq gb|KF254923.1| Enterovirus D68 isolate SO9306 VP1 gene, partial cds 1173 1173 83% 0.0 94% KF254923.1
Select seq gb|KF254920.1| Enterovirus D68 isolate SO9277 VP1 gene, partial cds 1173 1173 83% 0.0 94% KF254920.1
Select seq gb|KF254919.1| Enterovirus D68 isolate SO9320 VP1 gene, partial cds 1173 1173 83% 0.0 94% KF254919.1
Select seq gb|KF254917.1| Enterovirus D68 isolate SO9336 VP1 gene, partial cds 1171 1171 83% 0.0 94% KF254917.1
Select seq gb|JX101810.1| Human enterovirus 68 strain NYC458 from USA VP1 gene, partial cds 1171 1171 100% 0.0 89% JX101810.1
Select seq gb|JX101794.1| Human enterovirus 68 strain GA431 from Gambia VP1 gene, partial cds 1171 1171 100% 0.0 89% JX101794.1
Select seq dbj|AB614441.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2093-Yamagata-2010 1168 1168 100% 0.0 89% AB614441.1
Select seq gb|JX101811.1| Human enterovirus 68 strain NYC465 from USA VP1 gene, partial cds 1166 1166 99% 0.0 89% JX101811.1
Select seq gb|KF254924.1| Enterovirus D68 isolate SO9406 VP1 gene, partial cds 1164 1164 82% 0.0 95% KF254924.1
Select seq gb|KF726085.1| Enterovirus D68 isolate BCH895A, complete genome 1164 1164 99% 0.0 89% KF726085.1
Select seq gb|KC763177.1| Human enterovirus 68 strain ITA/34800/10 VP1 gene, partial cds 1162 1162 99% 0.0 89% KC763177.1
Select seq gb|KC763174.1| Human enterovirus 68 strain ITA/31742/10 VP1 gene, partial cds 1162 1162 99% 0.0 89% KC763174.1
Select seq gb|JX101814.1| Human enterovirus 68 strain NYC817 from USA VP1 gene, partial cds 1162 1162 100% 0.0 89% JX101814.1
Select seq gb|JX101804.1| Human enterovirus 68 strain NYC394 from USA VP1 gene, partial cds 1162 1162 100% 0.0 89% JX101804.1
Select seq gb|JX101787.1| Human enterovirus 68 strain SEN03 from Senegal VP1 gene, partial cds 1162 1162 100% 0.0 89% JX101787.1
Select seq gb|JX101808.1| Human enterovirus 68 strain NYC409 from USA VP1 gene, partial cds 1160 1160 99% 0.0 89% JX101808.1
Select seq gb|KF254913.1| Enterovirus D68 isolate ID72 VP1 gene, partial cds 1159 1159 83% 0.0 94% KF254913.1
Select seq gb|JX070222.1| Human enterovirus 68 isolate NZ-2010-541, complete genome 1159 1159 100% 0.0 88% JX070222.1
Select seq gb|JX101809.1| Human enterovirus 68 strain NYC435 from USA VP1 gene, partial cds 1159 1159 100% 0.0 88% JX101809.1
Select seq gb|JX101803.1| Human enterovirus 68 strain NYC369 from USA VP1 gene, partial cds 1159 1159 100% 0.0 88% JX101803.1
Select seq dbj|AB614442.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2174-Yamagata-2010 1159 1159 100% 0.0 88% AB614442.1
Select seq dbj|AB614440.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2076-Yamagata-2010 1159 1159 100% 0.0 88% AB614440.1
Select seq gb|KF254922.1| Enterovirus D68 isolate SO9288 VP1 gene, partial cds 1157 1157 82% 0.0 94% KF254922.1
Select seq gb|KJ472880.1| Enterovirus D68 isolate HEV085008 VP1 gene, partial cds 1155 1155 99% 0.0 89% KJ472880.1
Select seq gb|KJ472885.1| Enterovirus D68 isolate HEV137010 VP1 gene, partial cds 1153 1153 100% 0.0 88% KJ472885.1
Select seq gb|JX101813.1| Human enterovirus 68 strain NYC567 from USA VP1 gene, partial cds 1153 1153 100% 0.0 88% JX101813.1
Select seq dbj|AB614443.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2256-Yamagata-2010 1153 1153 100% 0.0 88% AB614443.1
Select seq dbj|AB614444.1| Human enterovirus 68 gene for polyprotein, VP1 protein region, strain: 2336-Yamagata-2010 1153 1153 100% 0.0 88% AB614444.1
Select seq gb|KJ472884.1| Enterovirus D68 isolate HEV126010 VP1 gene, partial cds 1151 1151 99% 0.0 89% KJ472884.1
Select seq gb|KC763159.1| Human enterovirus 68 strain ITA/19391/12 VP1 gene, partial cds 1148 1148 99% 0.0 88% KC763159.1
Select seq gb|JX101802.1| Human enterovirus 68 strain SA1354 from South Africa VP1 gene, partial cds 1148 1148 93% 0.0 90% JX101802.1
Select seq gb|AY426486.1| Human enterovirus 68 strain CA62-1 polyprotein gene, partial cds 1139 1139 99% 0.0 88% AY426486.1
Select seq gb|KM851231.1| Enterovirus D68 strain US/KY/14-18953, complete genome 1137 1137 99% 0.0 88% KM851231.1
Select seq gb|JF896311.1| Human enterovirus 68 isolate EV68_NL_200912598 VP1 protein gene, partial cds 1137 1137 80% 0.0 95% JF896311.1
Select seq gb|JF896308.1| Human enterovirus 68 isolate EV68_NL_200913563 VP1 protein gene, partial cds 1135 1135 79% 0.0 95% JF896308.1
Select seq gb|JF896309.1| Human enterovirus 68 isolate EV68_NL_200914986 VP1 protein gene, partial cds 1135 1135 79% 0.0 95% JF896309.1
Select seq gb|KJ472883.1| Enterovirus D68 isolate HEV124010 VP1 gene, partial cds 1133 1133 99% 0.0 88% KJ472883.1
Select seq gb|AY426487.1| Human enterovirus 68 strain CA62-2 polyprotein gene, partial cds 1133 1133 99% 0.0 88% AY426487.1
Select seq gb|JF896307.1| Human enterovirus 68 isolate EV68_NL_201012867 VP1 protein gene, partial cds 1131 1131 79% 0.0 95% JF896307.1
Select seq gb|JF896306.1| Human enterovirus 68 isolate EV68_NL_201013230 VP1 protein gene, partial cds 1131 1131 79% 0.0 95% JF896306.1
Select seq gb|KJ472878.1| Enterovirus D68 isolate HEV044008 VP1 gene, partial cds 1126 1126 100% 0.0 88% KJ472878.1
Select seq gb|JF896310.1| Human enterovirus 68 isolate EV68_NL_200914918 VP1 protein gene, partial cds 1126 1126 79% 0.0 95% JF896310.1
Select seq gb|JF896305.1| Human enterovirus 68 isolate EV68_NL_201014073 VP1 protein gene, partial cds 1126 1126 79% 0.0 95% JF896305.1
Select seq gb|JF896302.1| Human enterovirus 68 isolate EV68_NL_201013557 VP1 protein gene, partial cds 1122 1122 79% 0.0 94% JF896302.1
Select seq gb|JF896303.1| Human enterovirus 68 isolate EV68_NL_201012467 VP1 protein gene, partial cds 1122 1122 79% 0.0 94% JF896303.1
Select seq gb|AY426488.1| Human enterovirus 68 strain CA62-3 polyprotein gene, partial cds 1121 1121 99% 0.0 88% AY426488.1
Select seq gb|JF896304.1| Human enterovirus 68 isolate EV68_NL_201011595 VP1 protein gene, partial cds 1113 1113 79% 0.0 94% JF896304.1
Select seq gb|AY426531.1| Human enterovirus 68 strain Fermon, complete genome 1103 1103 99% 0.0 87% AY426531.1
Select seq gb|AF081348.1| Enterovirus 68 strain Fermon capsid protein VP1 (VP1) gene, partial cds 1103 1103 99% 0.0 87% AF081348.1
Select seq gb|AY355268.1| Human rhinovirus 87 VP1 capsid protein gene, partial cds 1088 1088 99% 0.0 87% AY355268.1
Select seq gb|KJ472882.1| Enterovirus D68 isolate HEV156010 VP1 gene, partial cds 1074 1074 99% 0.0 87% KJ472882.1
Select seq gb|JQ713912.1| Human enterovirus 68 isolate NZ-2010-541 VP1 protein gene, partial cds 984 984 87% 0.0 88% JQ713912.1
Select seq gb|JQ713911.1| Human enterovirus 68 isolate NZ-2010-539 VP1 protein gene, partial cds 984 984 87% 0.0 88% JQ713911.1
Select seq gb|JQ713904.1| Human enterovirus 68 isolate NZ-2010-1507 VP1 protein gene, partial cds 980 980 85% 0.0 88% JQ713904.1
Select seq gb|JQ713909.1| Human enterovirus 68 isolate NZ-2010-435 VP1 protein gene, partial cds 975 975 86% 0.0 88% JQ713909.1
Select seq gb|JQ713906.1| Human enterovirus 68 isolate NZ-2010-358 VP1 protein gene, partial cds 971 971 84% 0.0 88% JQ713906.1
Select seq gb|JQ713905.1| Human enterovirus 68 isolate NZ-2010-183 VP1 protein gene, partial cds 971 971 84% 0.0 88% JQ713905.1
Select seq gb|JQ586222.1| Human enterovirus 68, VP1, partial sequence, 09-85 971 971 68% 0.0 95% JQ586222.1
Select seq gb|JQ713907.1| Human enterovirus 68 isolate NZ-2010-404 VP1 protein gene, partial cds 964 964 85% 0.0 88% JQ713907.1
Select seq gb|JQ713910.1| Human enterovirus 68 isolate NZ-2010-481 VP1 protein gene, partial cds 962 962 84% 0.0 88% JQ713910.1
Select seq gb|JQ586223.1| Human enterovirus 68, VP1, partial sequence, 09-86 953 953 66% 0.0 95% JQ586223.1
Select seq gb|JQ586224.1| Human enterovirus 68, VP1, partial sequence, 09-115 951 951 66% 0.0 95% JQ586224.1
Select seq gb|JQ586226.1| Human enterovirus 68, VP1, partial sequence, 09-398 948 948 66% 0.0 95% JQ586226.1
Select seq gb|JQ586221.1| Human enterovirus 68, VP1, partial sequence, 09-56 944 944 67% 0.0 95% JQ586221.1
Select seq dbj|AB817708.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph597_VP1 939 939 65% 0.0 95% AB817708.1
Select seq dbj|AB817706.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph560_VP1 939 939 65% 0.0 95% AB817706.1
Select seq dbj|AB817705.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph519_VP1 939 939 65% 0.0 95% AB817705.1
Select seq dbj|AB817704.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph513_VP1 939 939 65% 0.0 95% AB817704.1
Select seq dbj|AB817702.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph343_VP1 939 939 65% 0.0 95% AB817702.1
Select seq dbj|AB817709.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph608_VP1 935 935 65% 0.0 95% AB817709.1
Select seq gb|JQ924863.1| Human enterovirus isolate CQ-3578 VP1 gene, partial cds 933 933 81% 0.0 88% JQ924863.1
Select seq gb|JQ924862.1| Human enterovirus isolate TJ-3395 VP1 gene, partial cds 933 933 81% 0.0 88% JQ924862.1
Select seq gb|KF254915.1| Enterovirus D68 isolate SO9749 VP1 gene, partial cds 931 931 81% 0.0 88% KF254915.1
Select seq dbj|AB817703.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph451_VP1 930 930 65% 0.0 95% AB817703.1
Select seq gb|JF896290.1| Human enterovirus 68 isolate EV68_NL_201012910 VP1 protein gene, partial cds 926 926 79% 0.0 89% JF896290.1
Select seq gb|KF254914.1| Enterovirus D68 isolate SO9770 VP1 gene, partial cds 924 924 83% 0.0 87% KF254914.1
Select seq gb|JQ411802.1| Human enterovirus D isolate TH_B1512 VP1 gene, partial cds 922 922 80% 0.0 88% JQ411802.1
Select seq gb|JF896300.1| Human enterovirus 68 isolate EV68_NL_201012472 VP1 protein gene, partial cds 922 922 79% 0.0 88% JF896300.1
Select seq gb|JF896299.1| Human enterovirus 68 isolate EV68_NL_201012584 VP1 protein gene, partial cds 922 922 79% 0.0 88% JF896299.1
Select seq gb|JF896295.1| Human enterovirus 68 isolate EV68_NL_201012756 VP1 protein gene, partial cds 922 922 79% 0.0 88% JF896295.1
Select seq gb|JF896294.1| Human enterovirus 68 isolate EV68_NL_201012721 VP1 protein gene, partial cds 922 922 79% 0.0 88% JF896294.1
Select seq gb|JF896289.1| Human enterovirus 68 isolate EV68_NL_201013352 VP1 protein gene, partial cds 922 922 79% 0.0 88% JF896289.1
Select seq gb|JX898784.1| Human enterovirus 68 isolate CQ4278 VP1 gene, partial cds 919 919 81% 0.0 88% JX898784.1
Select seq gb|JF896298.1| Human enterovirus 68 isolate EV68_NL_201012233 VP1 protein gene, partial cds 917 917 79% 0.0 88% JF896298.1
Select seq gb|JF896291.1| Human enterovirus 68 isolate EV68_NL_201012462 VP1 protein gene, partial cds 917 917 79% 0.0 88% JF896291.1
Select seq gb|JQ713908.1| Human enterovirus 68 isolate NZ-2010-431 VP1 protein gene, partial cds 915 915 80% 0.0 88% JQ713908.1
Select seq gb|JF896297.1| Human enterovirus 68 isolate EV68_NL_201011288 VP1 protein gene, partial cds 913 913 79% 0.0 88% JF896297.1
Select seq gb|JF896293.1| Human enterovirus 68 isolate EV68_NL_201012159 VP1 protein gene, partial cds 913 913 79% 0.0 88% JF896293.1
Select seq gb|JF896292.1| Human enterovirus 68 isolate EV68_NL_201014502 VP1 protein gene, partial cds 913 913 79% 0.0 88% JF896292.1
Select seq dbj|AB817711.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph245_VP1 911 911 65% 0.0 94% AB817711.1
Select seq dbj|AB817713.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph269_VP1 908 908 65% 0.0 94% AB817713.1
Select seq gb|JF896312.1| Human enterovirus 68 isolate EV68_NL_201013421 VP1 protein gene, partial cds 908 908 79% 0.0 88% JF896312.1
Select seq gb|JF896296.1| Human enterovirus 68 isolate EV68_NL_201012463 VP1 protein gene, partial cds 908 908 79% 0.0 88% JF896296.1
Select seq dbj|AB817716.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph395_VP1 906 906 65% 0.0 94% AB817716.1
Select seq gb|JF896287.1| Human enterovirus 68 isolate EV68_NL_201013226 VP1 protein gene, partial cds 904 904 79% 0.0 88% JF896287.1
Select seq gb|JF896288.1| Human enterovirus 68 isolate EV68_NL_201014542 VP1 protein gene, partial cds 904 904 79% 0.0 88% JF896288.1
Select seq dbj|AB817715.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph344_VP1 902 902 65% 0.0 94% AB817715.1
Select seq dbj|AB817712.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph257_VP1 902 902 65% 0.0 94% AB817712.1
Select seq gb|JQ411811.1| Human enterovirus D isolate TH_CU115 VP1 gene, partial cds 902 902 80% 0.0 88% JQ411811.1
Select seq gb|JQ411806.1| Human enterovirus D isolate TH_CU151 VP1 gene, partial cds 899 899 80% 0.0 87% JQ411806.1
Select seq gb|JF896301.1| Human enterovirus 68 isolate EV68_NL_201012493 VP1 protein gene, partial cds 899 899 79% 0.0 88% JF896301.1
Select seq gb|JQ924864.1| Human enterovirus isolate BJ-5234 VP1 gene, partial cds 892 892 81% 0.0 87% JQ924864.1
Select seq gb|JQ713913.1| Human enterovirus 68 isolate NZ-2010-571 VP1 protein gene, partial cds 877 877 79% 0.0 87% JQ713913.1
Select seq gb|JX898786.1| Human enterovirus 68 isolate CQ5914 VP1 gene, partial cds 870 870 80% 0.0 87% JX898786.1
Select seq gb|JQ411805.1| Human enterovirus D isolate TH_CU54 VP1 gene, partial cds 843 843 80% 0.0 86% JQ411805.1
Select seq gb|KF254916.1| Enterovirus D68 isolate SO9750 VP1 gene, partial cds 825 825 71% 0.0 88% KF254916.1
Select seq gb|JQ586231.1| Human enterovirus 68, VP1, partial sequence, 10-268 758 758 67% 0.0 88% JQ586231.1
Select seq gb|JQ586232.1| Human enterovirus 68, VP1, partial sequence, 10-283 753 753 67% 0.0 88% JQ586232.1
Select seq gb|JQ586230.1| Human enterovirus 68, VP1, partial sequence, 10-260 744 744 66% 0.0 88% JQ586230.1
Select seq dbj|AB817714.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph272_VP1 729 729 65% 0.0 88% AB817714.1
Select seq dbj|AB817710.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-11-Ph224_VP1 729 729 65% 0.0 88% AB817710.1
Select seq dbj|AB817707.1| Human enterovirus 68 VP1 gene for capsid protein VP1, partial cds, note: Hospital study number: TTa-08-Ph561_VP1 726 726 65% 0.0 87% AB817707.1
Select seq gb|JQ411810.1| Human enterovirus D isolate TH_CU110 VP1 gene, partial cds 720 720 65% 0.0 87% JQ411810.1
Select seq dbj|AB902837.1| Enterovirus D68 gene for polyprotein, partial cds, strain: EV68/Okinawa/174/2010 711 711 50% 0.0 95% AB902837.1
Select seq gb|JQ411801.1| Human enterovirus D isolate TH_CU70 VP1 gene, partial cds 688 688 65% 0.0 86% JQ411801.1
Select seq gb|KJ472888.1| Enterovirus D68 isolate HEV016008 VP1 gene, partial cds 580 580 44% 2e-161 92% KJ472888.1
Select seq gb|KJ556327.1| Enterovirus D68 isolate CSP329 VP1 gene, partial cds 569 569 39% 3e-158 95% KJ556327.1
Select seq dbj|AB920412.1| Enterovirus D68 gene for polyprotein, partial cds, strain: EV68/Okinawa/228/2013 554 554 50% 6e-154 87% AB920412.1
Select seq gb|KJ472881.1| Enterovirus D68 isolate HEV112009 VP1 gene, partial cds 551 551 48% 8e-153 88% KJ472881.1
Select seq gb|JF830048.1| Human enterovirus 68 strain 4310901880 capsid VP1 gene, partial cds 544 544 37% 1e-150 96% JF830048.1
Select seq gb|JF830047.1| Human enterovirus 68 strain 4310901514 capsid VP1 gene, partial cds 540 540 37% 1e-149 95% JF830047.1
Select seq gb|JF830045.1| Human enterovirus 68 strain 4310900947 capsid VP1 gene, partial cds 540 540 37% 1e-149 95% JF830045.1
Select seq gb|KJ472879.1| Enterovirus D68 isolate HEV082008 VP1 gene, partial cds 536 536 47% 2e-148 88% KJ472879.1
Select seq gb|JF830049.1| Human enterovirus 68 strain 4310902042 capsid VP1 gene, partial cds 535 535 37% 6e-148 95% JF830049.1
Select seq gb|KJ472887.1| Enterovirus D68 isolate HEV199011 VP1 gene, partial cds 531 531 46% 7e-147 88% KJ472887.1
Select seq gb|KJ472890.1| Enterovirus D68 isolate HEV117010 VP1 gene, partial cds 526 526 49% 3e-145 86% KJ472890.1
Select seq gb|JF830021.1| Human enterovirus 68 strain 3000000227 capsid VP1 gene, partial cds 499 499 37% 4e-137 93% JF830021.1
Select seq gb|JF830020.1| Human enterovirus 68 strain 3009903700 capsid VP1 gene, partial cds 499 499 37% 4e-137 93% JF830020.1
Select seq gb|JF830017.1| Human enterovirus 68 strain 3009604041 capsid VP1 gene, partial cds 480 480 36% 1e-131 92% JF830017.1
Select seq gb|JF830050.1| Human enterovirus 68 strain 4310902284 capsid VP1 gene, partial cds 471 471 37% 6e-129 91% JF830050.1
Select seq gb|JF830037.1| Human enterovirus 68 strain 4310800704 capsid VP1 gene, partial cds 471 471 37% 6e-129 91% JF830037.1
Select seq gb|JF830040.1| Human enterovirus 68 strain 4310800762 capsid VP1 gene, partial cds 471 471 37% 6e-129 91% JF830040.1
Select seq gb|JF830042.1| Human enterovirus 68 strain 4310800806 capsid VP1 gene, partial cds 471 471 37% 6e-129 91% JF830042.1
Select seq gb|JF830074.1| Human enterovirus 68 strain V031 capsid VP1 gene, partial cds 470 470 37% 2e-128 91% JF830074.1
Select seq gb|JF830079.1| Human enterovirus 68 strain V493 capsid VP1 gene, partial cds 470 470 37% 2e-128 91% JF830079.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 29, 2014 12:51 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Genome Sequencing of Enterovirus D68 Circulating in St. Louis
OCTOBER 29, 2014

Enterovirus D68 Genomic SequencingResearchers at Washington University School of Medicine in St. Louis have sequenced the genome of enterovirus D68 sampled from patients treated at St. Louis Children’s Hospital. Nationwide, the virus has spread rapidly in recent months and caused severe respiratory illness in young children, with some patients requiring hospitalization.

“Having the DNA sequence of this virus enables additional research,” said senior author Gregory A. Storch, MD, the Ruth L. Siteman Professor of Pediatrics. “It can be used to create better diagnostic tests. It also may help us understand why this epidemic seems to be producing severe and unusual disease, and why it’s spreading more extensively than in the past.”

The work was recently published in Emerging Infectious Diseases (EID). The investigators published the DNA sequences in GenBank, an open-access database maintained by the National Institutes of Health (NIH).

The new sequencing data, produced by the Genome Institute at Washington University, includes one complete genome sequence and eight partial sequences taken from patient samples. Further, scientists at the Centers for Disease Control and Prevention (CDC) contributed to GenBank seven complete or partial sequences of enterovirus D68 sampled in the Midwest.

Storch said routine laboratory tests can’t identify specific enterovirus strains. Most hospitals and clinics only can perform tests to determine if a patient has a virus that fits broadly into the enterovirus/rhinovirus category. In the new study, Storch and his colleagues analyzed 14 patient samples testing positive for enterovirus/rhinovirus. Of those, nine were identified as enterovirus D68 using specialized laboratory techniques developed at Washington University and St. Louis Children’s Hospital. The remaining five samples were other respiratory viruses.

While many children may contract enterovirus D68 and never know it because symptoms are mild, others may require hospitalization to support their breathing. Children with a history of breathing disorders such as asthma are at higher risk of severe disease.

In this study, seven of the nine patients with the D68 strain had severe disease that required admission to the pediatric intensive care unit. The remaining two had moderate symptoms resulting in general hospital admission. Of the five patients with other viruses, three were classified with severe disease. The only two patients discharged home with mild disease did not have the D68 strain.

“There is currently no specific treatment and no vaccine for this virus,” said Storch, who treats patients at St. Louis Children’s Hospital. “But having the DNA sequence available helps work toward both of those goals.”

The data also allow comparisons between strains circulating in different parts of the country.

“The CDC has published some additional genomes from Missouri, Illinois and Kentucky,” said first author Kristine M. Wylie, PhD, research instructor in pediatrics. “The Missouri genomes, including ours, are all very similar, but the Illinois and Kentucky genomes are different from the Missouri types, suggesting there are some distinct strains circulating in the U.S. right now.”

Wylie also pointed out the importance of continuing to characterize the genetic features of this virus and monitor the health of patients with the D68 strain.

“Until recently, this virus has been pretty rare,” she said. “It would be helpful to have more data about the virus and the patients so that we can start to associate the genetic features of the virus with the severity of the disease.”

The research was supported by the National Institutes of Health and the Alan A. and Edith L. Wolff Distinguished Professorship at Washington University School of Medicine in St. Louis.

Read more at EID: Genome Sequence of Enterovirus D68 from St. Louis, Missouri, USA.

- See more at: http://globalbiodefense.com/2014/10/29/ ... XMGKh.dpuf

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 29, 2014 1:34 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EID thread

viewtopic.php?f=5&t=12841

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Bing [Bot] and 57 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group