Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 11:24 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Mon Sep 01, 2014 11:12 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The sequence of the Ebola in DR Congo is the Zaire clade and is 99% identical to Kikwit (the DR Congo isolate from the 1995 outbreak). This identity is higher than the 97% identity between the the sequences from western Africa and Kikwit.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Sep 01, 2014 11:16 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Sequencing results conducted on samples sent to Germany revealed the Zaire strain to 99% homology with Kikwit on all samples received Boende.

http://www.rdc-humanitaire.net/index.ph ... -aout-2014

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Sep 01, 2014 11:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS JQ352763 18944 bp cRNA linear VRL 23-JAN-2013
DEFINITION Zaire ebolavirus strain Kikwit, complete genome.
ACCESSION JQ352763
VERSION JQ352763.1 GI:384406804
KEYWORDS .
SOURCE Zaire ebolavirus (ZEBOV)
ORGANISM Zaire ebolavirus
Viruses; ssRNA negative-strand viruses; Mononegavirales;
Filoviridae; Ebolavirus.
REFERENCE 1 (bases 1 to 18944)
AUTHORS Bjornson-Hooper,Z.B., Honko,A., Gire,S.K., Sabeti,P.C. and
Hensley,L.E.
TITLE Direct Submission
JOURNAL Submitted (04-JAN-2012) Virology, United States Army Medical
Research Institute for Infectious Diseases, 1425 Porter St,
Frederick, MD 21702, USA
FEATURES Location/Qualifiers
source 1..18944
/organism="Zaire ebolavirus"
/mol_type="viral cRNA"
/strain="Kikwit"
/db_xref="taxon:186538"
/country="Zaire"
/collection_date="04-May-1995"
/note="USAMRIID_ID#16502;
Vero E6 passage #3"
5'UTR <1..41
/note="putative leader region; regulation or initiation of
RNA replication region"
gene 42..3012
/gene="NP"
/locus_tag="ZEBOVgp1"
mRNA 42..3012
/gene="NP"
/locus_tag="ZEBOVgp1"
/product="nucleoprotein"
misc_signal 42..53
/gene="NP"
/locus_tag="ZEBOVgp1"
/note="putative; transcription start signal"
CDS 456..2675
/gene="NP"
/locus_tag="ZEBOVgp1"
/note="nucleoprotein"
/codon_start=1
/product="NP"
/protein_id="AFH89480.1"
/db_xref="GI:384406805"
/translation="MDSRPQKVWMTPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVY
QVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGH
GFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPK
LVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQG
MHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNE
VNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTN
AMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQ
DTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQ
KNSQKGQHTEGRQTQSRPTQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPIN
EEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKRELPQDE
QQDQDHTQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSD
GKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ"
misc_feature 510..2657
/gene="NP"
/locus_tag="ZEBOVgp1"
/note="Ebola nucleoprotein; Region: Ebola_NP; pfam05505"
/db_xref="CDD:147601"
polyA_signal 3001..3012
/gene="NP"
/locus_tag="ZEBOVgp1"
gene 3018..4393
/gene="VP35"
/locus_tag="ZEBOVgp2"
mRNA 3018..4393
/gene="VP35"
/locus_tag="ZEBOVgp2"
/product="VP35"
misc_signal 3018..3029
/gene="VP35"
/locus_tag="ZEBOVgp2"
/note="putative; transcription start signal"
CDS 3115..4137
/gene="VP35"
/locus_tag="ZEBOVgp2"
/function="polymerase complex protein"
/codon_start=1
/product="VP35"
/protein_id="AFH89481.1"
/db_xref="GI:384406806"
/translation="MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIF
CDIENNPGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTI
ASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATE
AYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPD
ISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGK
TLGLKI"
misc_feature 3172..4134
/gene="VP35"
/locus_tag="ZEBOVgp2"
/note="Filoviridae VP35; Region: Filo_VP35; pfam02097"
/db_xref="CDD:145320"
gene 4376..5880
/gene="VP40"
/locus_tag="ZEBOVgp3"
mRNA 4376..5880
/gene="VP40"
/locus_tag="ZEBOVgp3"
misc_signal 4376..4387
/gene="VP35"
/locus_tag="ZEBOVgp2"
/note="transcription start signal"
polyA_signal 4383..4393
/gene="VP35"
/locus_tag="ZEBOVgp2"
CDS 4465..5445
/gene="VP40"
/locus_tag="ZEBOVgp3"
/note="matrix protein"
/codon_start=1
/product="VP40"
/protein_id="AFH89482.1"
/db_xref="GI:384406807"
/translation="MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNG
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVAD
QKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQE
FVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILL
PNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKV
TSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK"
misc_feature 4465..5349
/gene="VP40"
/locus_tag="ZEBOVgp3"
/note="Matrix protein VP40; Region: VP40; pfam07447"
/db_xref="CDD:116068"
polyA_signal 5869..5880
/gene="VP40"
/locus_tag="ZEBOVgp3"
gene 5886..8292
/gene="GP"
/locus_tag="ZEBOVgp4"
mRNA 5886..8292
/gene="GP"
/locus_tag="ZEBOVgp4"
/product="sGP"
/note="unedited mRNA"
misc_signal 5886..5897
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="putative; transcription start signal"
CDS 6025..8055
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="encodes two disulfide-linked subunits GP1 and GP2"
/codon_start=1
/product="virion spike glycoprotein precursor"
/protein_id="AFH89483.1"
/db_xref="GI:384406808"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSXVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNRAKNISGQSPARTSSDPGTNT
TTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQPPTTKPGPDNSTHNTP
VYKLDISEATQVEQHHRRTDNDSTASDTPPATTAAGPLKAENTNTSKGTDLLDPATTT
SPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRARREAIVNAQ
PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETT
QALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKID
QIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF"
misc_feature 7693..7911
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="heptad repeat 1-heptad repeat 2 region of the
transmembrane subunit of Filoviridae viruses, Ebola virus
and Marburg virus, and related domains; Region:
Ebola-like_HR1-HR2; cd09850"
/db_xref="CDD:197367"
misc_feature 6067..7140
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="Filovirus glycoprotein; Region: Filo_glycop;
pfam01611"
/db_xref="CDD:110602"
misc_feature 7693..7719
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR1A; other site"
/db_xref="CDD:197367"
misc_feature 7720..7749
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR1B; other site"
/db_xref="CDD:197367"
misc_feature 7750..7770
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR1C; other site"
/db_xref="CDD:197367"
misc_feature 7771..7818
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR1D; other site"
/db_xref="CDD:197367"
misc_feature 7774..7824
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="immunosuppressive region; other site"
/db_xref="CDD:197367"
misc_feature order(7825..7845,7846..7848)
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="CX(6,7)C motif; other site"
/db_xref="CDD:197367"
misc_feature 7873..7911
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR2; other site"
/db_xref="CDD:197367"
misc_feature order(7771..7773,7780..7782)
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="Cl binding site [ion binding]; other site"
/db_xref="CDD:197367"
misc_feature order(7693..7701,7705..7710,7714..7719,7723..7731,
7735..7743,7747..7752,7756..7764,7768..7794,7798..7806,
7810..7815,7831..7836,7843..7845,7852..7863,7867..7869,
7876..7881,7888..7890,7897..7902,7909..7911)
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="homotrimer interface [polypeptide binding]; other
site"
/db_xref="CDD:197367"
misc_feature order(7693..7701,7705..7713,7717..7722,7726..7734,
7741..7755,7759..7770,7774..7779,7783..7791,7795..7800,
7804..7806)
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="HR1-GP1 interface [polypeptide binding]; other
site"
/db_xref="CDD:197367"
CDS join(6025..6909,6911..7120)
/gene="GP"
/locus_tag="ZEBOVgp4"
/ribosomal_slippage
/note="small non-structural, secreted glycoprotein; sGP
secreted as an anti-parallel-oriented homodimer"
/codon_start=1
/product="sGP"
/protein_id="AFH89484.1"
/db_xref="GI:384406809"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSXVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTEPKTSVVRVRRELLPTQGPTQ
QLKTTKSWLQKIPLQWFKCTVKEGKLQCRI"
misc_feature join(6067..6909,6911..7117)
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="Filovirus glycoprotein; Region: Filo_glycop;
pfam01611"
/db_xref="CDD:110602"
CDS join(6025..6909,6909..6920)
/gene="GP"
/locus_tag="ZEBOVgp4"
/ribosomal_slippage
/note="second non-structural secreted glycoprotein;
secreted in a monomeric form; one A residue is deleted or
two additional A residues are inserted at the editing site
during transcription of the GP gene (see comment for ssGP
in NC_002549)"
/codon_start=1
/product="ssGP"
/protein_id="AFH89485.1"
/db_xref="GI:384406810"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSXVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKKPH"
misc_feature 6067..>6909
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="Filovirus glycoprotein; Region: Filo_glycop;
pfam01611"
/db_xref="CDD:110602"
misc_feature 7516..7527
/gene="GP"
/locus_tag="ZEBOVgp4"
/note="predicted site of glycoprotein cleavage based on
alignment with NC_002549"
gene 8275..9727
/gene="VP30"
/locus_tag="ZEBOVgp5"
mRNA 8275..9727
/gene="VP30"
/locus_tag="ZEBOVgp5"
/product="VP30"
misc_signal 8275..8286
/gene="VP30"
/locus_tag="ZEBOVgp5"
/note="putative; transcription start signal"
polyA_signal 8282..8292
/gene="VP30"
/locus_tag="ZEBOVgp5"
CDS 8496..9362
/gene="VP30"
/locus_tag="ZEBOVgp5"
/note="minor nucleoprotein; polymerase complex protein"
/codon_start=1
/product="VP30"
/protein_id="AFH89486.1"
/db_xref="GI:384406811"
/translation="MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRS
ASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLL
LIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIR
TIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDK
GGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTN
PGTCSWSDEGTP"
misc_feature 8919..9308
/gene="VP30"
/locus_tag="ZEBOVgp5"
/note="Ebola virus-specific transcription factor VP30;
Region: Transcript_VP30; pfam11507"
/db_xref="CDD:151944"
polyA_signal 9717..9727
/gene="VP30"
/locus_tag="ZEBOVgp5"
/note="putative"
gene 9872..11505
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="putative"
mRNA 9872..11505
/gene="VP24"
/locus_tag="ZEBOVgp6"
/product="VP24"
misc_signal 9872..9883
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="transcription start signal"
CDS 10332..11087
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="membrane-associated protein"
/codon_start=1
/product="VP24"
/protein_id="AFH89487.1"
/db_xref="GI:384406812"
/translation="MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAG
IEFDVTHKGMALLQRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGI
QDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKF
INRLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRKKPGPAK
FSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI"
misc_feature 10356..11027
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="Filovirus membrane-associated protein VP24; Region:
Filo_VP24; pfam06389"
/db_xref="CDD:253701"
gene 11472..18269
/gene="L"
/locus_tag="ZEBOVgp7"
polyA_signal 11472..11483
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="putative"
mRNA 11488..18269
/gene="L"
/locus_tag="ZEBOVgp7"
/product="L"
misc_signal 11488..11499
/gene="VP24"
/locus_tag="ZEBOVgp6"
/note="transcription start signal"
polyA_signal 11495..11505
/gene="VP24"
/locus_tag="ZEBOVgp6"
CDS 11568..18206
/gene="L"
/locus_tag="ZEBOVgp7"
/note="polymerase; synthesis of viral RNAs;
transcriptional RNA editing"
/codon_start=1
/product="L"
/protein_id="AFH89488.1"
/db_xref="GI:384406813"
/translation="MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNC
KLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPILLKALSGNGFCPVEPRCQQFLDE
IIKYTMQDALFLKYYLKNVGAQEDCVDDHFQEKILSSIQGNEFLHQMFFWYDLAILTR
RGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISMLPLNTQGIPHAAMDWYQASVF
KEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEIEDPVCSDYPNFKIVSML
YQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEI
TEMRALKPSQAQKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKH
ATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPP
LPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPP
HKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKL
PYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATV
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNP
PHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVM
GDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGF
IYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFP
CRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSF
LNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGL
NVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRF
AADIFSRTPSGKRLQILGYLEGTRTLLASRIINNNTETPVLDRLRKITLQRWSLWFSY
LDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVFWLKP
YEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRLSWTIGDGIPYIGSRTEDKIGQ
PAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSH
YSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENE
LIYDNNPLKGGLNCNISFDNPFFQGKQLNIIEDDLIRLPHLSGWELAKTIMQSIISDS
NNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYY
LTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLR
TSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLYQIVELLVHDSSRQQAL
KTTISDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKYLARDSSTRSSTNNS
DGHIERSQEQTTRDPHDGTERNLVLQMSHEIKRTTIPQENTHQGPSFQSFLSYSACGT
ANPKLNFDRSRHNVKSQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQ
DEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIESFKSAVTLAEGEGAGAL
LLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQ
ITDITNPTWFKDQRARLPKQVEVITMDAETTENINRSKLYEAVYKLILHHIDPSVLKA
VVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPH
QNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCDLHLSYIRLGFPSLEKVLYHRYNL
VDSKRGPLVSITQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYL
KFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSE
VKLIERLTGLLSLFPDGLYRFD"
misc_feature 11595..14840
/gene="L"
/locus_tag="ZEBOVgp7"
/note="Mononegavirales RNA dependent RNA polymerase;
Region: Mononeg_RNA_pol; pfam00946"
/db_xref="CDD:250248"
misc_feature 15210..18179
/gene="L"
/locus_tag="ZEBOVgp7"
/note="mRNA capping enzyme, paramyxovirus family; Region:
paramyx_RNAcap; TIGR04198"
/db_xref="CDD:234496"
polyA_signal 18259..18269
/gene="L"
/locus_tag="ZEBOVgp7"
3'UTR 18270..>18944
/note="putative trailer region; regulation or initiation
of RNA replication"
ORIGIN
1 gaaagaagaa tttttwggat cttttgtgtg cgaataacta tgaggaagat taataatttt
61 cctctcattg aaatttatat cggaatttaa attgaaattg ttactgtaat cacacctggt
121 ttgtttcaga gccacatcac aaagatagag aacaacctag gtctctgaag ggagcaaggg
181 catcagtgtg ctcagttgaa aatcccttgt caacatctag gtcttatcac atcacaagtc
241 ccacctcaga ctctgcaggg tgatccaaca accttaatag aaacattatt gttaaaggac
301 agcattagtt cacagtcaaa caagcaagat tgagaattaa ccttggtttt gaacttgaat
361 acttagagga ttggagattc aacaacccta aagcttgggg taaaacattg gaaatagtta
421 aaagacaaat tgctcggaat cacaacattc cgagtatgga ttctcgtcct cagaaagtct
481 ggatgacgcc gagtctcact gaatctgaca tggattacca caagatcttg acagcaggtc
541 tgtccgttca acaggggatt gttcggcaaa gagtcatccc agtgtatcaa gtaaacaatc
601 ttgaggagat ttgccaactt atcatacagg cctttgaagc aggtgttgat tttcaagaga
661 gtgcggacag tttccttctc atgctttgtc ttcatcatgc gtaccaggga gattacaaac
721 ttttcttgga aagtggcgca gtcaagtatt tggaagggca cgggttccgt tttgaagtca
781 agaagcgtga tggagtgaag cgccttgagg aattgctgcc agcagtatct agtggaaaaa
841 acattaagag aacacttgct gccatgccgg aagaggagac aactgaagct aatgccggtc
901 agtttctctc ctttgcaagt ctattccttc cgaaattggt agtaggagaa aaggcttgtc
961 ttgagaaggt tcaaaggcaa attcaagtac atgcagagca aggactgata caatatccaa
1021 cagcttggca atcagtagga cacatgatgg tgattttccg tttgatgcga acaaattttt
1081 tgatcaaatt tctcctaata caccaaggga tgcacatggt tgccgggcat gatgccaacg
1141 acgctgtgat ttcaaattca gtggctcaag ctcgtttttc aggtttattg attgtcaaaa
1201 cagtacttga tcatatccta caaaagacag aacgcggagt tcgtctccat cctcttgcaa
1261 ggaccgccaa ggtaaaaaat gaggtgaact cctttaaggc tgcactcagc tccctggcca
1321 agcatggaga gtatgctcct ttcgcccgac ttttgaacct ttctggagta aataatcttg
1381 agcatggtct tttccctcaa ctatcagcaa ttgcactcgg agtcgccaca gcacacggga
1441 gtaccctcgc aggagtaaat gttggagaac agtatcaaca actcagagag gctgccactg
1501 aggctgagaa gcaactccaa caatacgcag agtctcgcga acttgaccat cttggacttg
1561 atgatcagga aaagaaaatt cttatgaact tccatcagaa aaagaacgaa atcagcttcc
1621 agcaaacaaa cgctatggta actctaagaa aagagcgcct ggccaagctg acggaagcta
1681 tcactgctgc gtcactgccc aaaacaagtg gacattacga tgatgatgac gacattccct
1741 ttccaggacc catcaatgat gacgacaatc ctggccatca agatgatgat ccaactgact
1801 cacaagatac gaccattcct gatgtggtgg ttgatcccga tgatggaagc tacggcgaat
1861 accagagtta ctcggaaaac ggcatgaatg caccagatga cttggtccta ttcgatctag
1921 acgaggacga tgaggacact aagccagtgc ctaatagatc aaccaagggt ggacaacaga
1981 aaaacagtca aaagggccag catacagagg gcagacagac acaatccagg ccaactcaaa
2041 atgtcccagg ccctcacaga acaatccacc acgccagtgc tccactcacg gataatgaca
2101 gaagaaatga accctccggc tcaaccagcc ctcgcatgct gacaccaatc aacgaagagg
2161 cagacccact ggacgatgcc gacgacgaga cgtctagcct tccgcccctg gagtcagacg
2221 atgaagaaca ggacagggac ggaacttcca accgcacacc cactgtcgcc ccaccggctc
2281 ccgtatacag agatcactct gaaaagagag aactcccgca agatgagcaa caagatcagg
2341 accacactca agaggccagg aaccaggaca gtgacaacac ccagccagaa cactcttttg
2401 aggagatgta tcgccacatt ctaagatcac aggggccatt tgatgctgtt ttgtattatc
2461 atatgatgaa ggatgagcct gtagttttca gtaccagtga tggcaaagag tacacgtatc
2521 cagactccct tgaagaggaa tatccaccat ggctcactga aaaagaggct atgaatgaag
2581 agaatagatt tgttacattg gatggtcaac aattttattg gccggtaatg aatcacaaga
2641 ataaattcat ggcaatcctg caacatcatc agtgaatgag catggaacaa tgggatgatt
2701 caaccgacaa atagctaaca ttaggtagtc aaggaacgaa aacaggaaga atttttgatg
2761 tctaaggtgt gaattattat cacaataaaa gtgattctta tttttgaatt taaagctagc
2821 ttattattac tagccgtttt tcaaagtcca atttgagtct taatgcaaat aggcgttaag
2881 ccacagttat agccataatt gtaactcaat atcctaacta gcgatttatc taaattaaat
2941 tacattatgc ttttataact tacctactag cctacccaac atttacacga tcattttata
3001 attaagaaaa aactaatgat gaagattaaa accttcatca tccttacgtc aattgaattc
3061 tctagcactc gaagcttatt gtcctcaatg taaaagaaaa gctggtctaa caagatgaca
3121 accagaacaa agggcagggg ccacactgcg gccacgactc aaaacgacag aatgccaggc
3181 cctgagcttt cgggctggat ctctgagcag ctaatgaccg gaagaattcc tgtaagcgac
3241 atcttctgtg atattgagaa caatccagga ttatgctacg catcccaaat gcaacaaacc
3301 aagccaaacc cgaagacgcg caacagtcaa acccaaacgg acccaatttg caatcatagt
3361 tttgaggagg tagtacaaac attagcttca ttggctactg ttgtgcaaca acaaaccatt
3421 gcatcagaat cattagaaca acgcattacg agtcttgaga atggtctaaa gccagtttat
3481 gatatggcta aaacaatctc ctcattgaac agggtttgtg ctgagatggt tgcaaaatat
3541 gatcttctgg tgatgacaac cggtcgggca acagcaaccg ctgcggcaac tgaggcttat
3601 tgggccgaac atggtcaacc accacctgga ccatcacttt atgaagaaag tgcaattcgg
3661 ggtaagattg aatctagaga tgagaccgtc cctcaaagtg ttagggaggc attcaacaat
3721 ctagacagta ccacttcact aactgaggaa aattttggga aacctgacat ttcggcaaag
3781 gatttgagaa acattatgta tgatcacttg cctggttttg gaactgcttt ccaccaatta
3841 gtacaagtga tttgtaaatt gggaaaagat agcaactcat tggacatcat tcatgctgag
3901 ttccaggcca gcctggctga aggagactct cctcaatgtg ccctaattca aattacaaaa
3961 agagttccaa tcttccaaga tgctgctcca cctgtcatcc acatccgctc tcgaggtgac
4021 attccccgag cttgccagaa aagcttgcgt ccagtcccac catcgcccaa gattgatcga
4081 ggttgggtat gtgtttttca gcttcaagat ggtaaaacac ttggactcaa aatttgagcc
4141 catcttcctt ccctccgaaa gaggcgacta atagcagagg cttcaactgc tgaactatag
4201 ggtacgttac attaatgata cacttgtgag tatcagccct ggataatata agtcaattaa
4261 acgaccaaga taaaattgtt cttatctcgc tagcagctta aaatatgaat gtaataggag
4321 ctatatctct gacagtatta taatcaatcg ttattaagta acccaaacca aaagtgatga
4381 agattaagaa aaacctacct cgactgagag agtgtttttt cattaacctt catcttgtaa
4441 acgttgagca aaattgttaa aaatatgagg cgggttatat tacctactgc tcctcctgaa
4501 tatatggagg ccatataccc tgtcaggtca aattcaacaa ttgctagagg tggcaacagc
4561 aatacaggct tcctgacacc ggagtcagtc aatggggaca ctccatcgaa tccactcagg
4621 ccaattgccg atgacaccat cgaccatgcc agccacacac caggcagtgt gtcatcagca
4681 ttcatccttg aagctatggt gaatgtcata tcgggcccca aagtgctaat gaagcaaatt
4741 ccaatttggc ttcctctagg tgtcgctgat caaaagacct acagctttga ctcaacaacg
4801 gccgccatca tgcttgcttc atatactatc acccatttcg gcaaggcaac caatccactt
4861 gtcagagtca atcggctggg tcctggaatc ccggatcacc ccctcaggct cctgcgaatt
4921 ggaaaccagg ccttcctcca ggagttcgtt cttccgccag tccaactacc ccagtatttc
4981 acctttgatt tgacagcact caaactgatc acccaaccac tgcctgctgc aacatggacc
5041 gatgacactc caacaggatc aaatggagcg ttgcgcccag ggatttcatt tcatccaaaa
5101 cttcgcccca ttcttttacc caacaagagt gggaagaagg ggaatagtgc cgatctaaca
5161 tctccggaga aaatccaagc aataatgact tcactccagg actttaagat cgttccaatt
5221 gatccaacca aaaatatcat gggaatcgaa gtgccagaaa ctctggtcca caagctgacc
5281 ggtaagaagg tgacttctaa aaatggacaa ccaatcatcc ctgttctttt gccaaagtac
5341 attggtttgg acccggtggc tccaggagac ctcaccatgg taatcacaca ggattgtgac
5401 acgtgtcatt ctcctgcgag tcttccagct gtgattgaga agtaattgca ataattgact
5461 cagatccagt tttacagaat cttctcaggg atagtgataa catctattta gtaatccgtc
5521 cattagagga gatactttta attgatcaat atactaaagg tgctttacac cattgtcttt
5581 ttcctctcct aaatgtagaa cttaacaaaa gactcataat atacttgttt ttaaaagatt
5641 gattgatgaa agatcataac taataacatt acaaataatc ctactataat caatacggtg
5701 atccaaatgt taatctttct cattgcaaat actctttgcc cttatcctca aattgcctac
5761 atgcttacat ctgaggatag ccagtgtgac ttggattgga gatgtggaga aaaaatcggg
5821 acccatttct aggttgttca ccatccaagt acagacattg cccttctaat taagaaaaaa
5881 tcggcgatga agattaagcc gacagtgagc gtaatcttca tctctcttag attatttgtc
5941 ctccagagta gggatcgtca ggtccttttc aatcgtataa ccaaaataaa cttcactaga
6001 aggatattgt ggggcaacaa cacaatgggt gttacaggaa tattgcagtt acctcgtgat
6061 cgattcaaga ggacatcatt ctttctttgg gtaattatcc ttttccaaag aacattttcc
6121 atcccacttg gagtcatcca caatagcaca ttacaggtta gtgakgtcga caaactggtt
6181 tgccgtgaca aactgtcatc cacaaatcaa ttgagatcag ttggactgaa tctcgaaggg
6241 aatggagtgg caactgacgt gccatctgca actaaaagat ggggcttcag gtccggtgtc
6301 ccaccaaagg tggtcaatta tgaagctggt gaatgggctg aaaactgcta caatcttgaa
6361 atcaaaaaac ctgacgggag tgagtgtcta ccagcagcgc cagacgggat tcggggcttc
6421 ccccggtgcc ggtatgtgca caaagtatca ggaacgggac cgtgtgccgg agactttgcc
6481 ttccacaaag agggtgcttt cttcctgtat gaccgacttg cttccacagt tatctaccga
6541 ggaacgactt tcgctgaagg tgtcgttgca tttctgatac tgccccaagc taagaaggac
6601 ttcttcagct cacacccctt gagagagccg gtcaatgcaa cggaggaccc gtctagtggc
6661 tactattcta ccacaattag atatcaagct accggttttg gaaccaatga gacagagtat
6721 ttgttcgagg ttgacaattt gacctacgtc caacttgaat caagattcac accacagttt
6781 ctgctccagc tgaatgagac aatatataca agtgggaaaa ggagcaatac cacgggaaaa
6841 ctaatttgga aggtcaaccc cgaaattgat acaacaatcg gggagtgggc cttctgggaa
6901 actaaaaaaa acctcactag aaaaattcgc agtgaagagt tgtctttcac agctgtatca
6961 aacagagcca aaaacatcag tggtcagagt ccggcgcgaa cttcttccga cccagggacc
7021 aacacaacaa ctgaagacca caaaatcatg gcttcagaaa attcctctgc aatggttcaa
7081 gtgcacagtc aaggaaggga agctgcagtg tcgcatctga caacccttgc cacaatctcc
7141 acgagtcctc aaccccccac aaccaaacca ggtccggaca acagcaccca caatacaccc
7201 gtgtataaac ttgacatctc tgaggcaact caagttgaac aacatcaccg cagaacagac
7261 aacgacagca cagcctccga cactcccccc gccacgaccg cagccggacc cctaaaagca
7321 gagaacacca acacgagcaa gggtaccgac ctcctggacc ccgccaccac aacaagtccc
7381 caaaaccaca gcgagaccgc tggcaacaac aacactcatc accaagatac cggagaagag
7441 agtgccagca gcgggaagct aggcttaatt accaatacta ttgctggagt cgcaggactg
7501 atcacaggcg ggaggagagc tcgaagagaa gcaattgtca atgctcaacc caaatgcaac
7561 cctaatttac attactggac tactcaggat gaaggtgctg caatcggact ggcctggata
7621 ccatatttcg ggccagcagc cgagggaatt tacacagagg ggctgatgca caatcaagat
7681 ggtttaatct gtgggttgag acagctggcc aacgagacga ctcaagctct tcaactgttc
7741 ctgagagcca caaccgagct acgcaccttt tcaatcctca accgtaaggc aattgatttc
7801 ttgctgcagc gatggggcgg cacatgccac attttgggac cggactgctg tatcgaacca
7861 catgattgga ccaagaacat aacagacaaa attgatcaga ttattcatga ttttgttgat
7921 aaaacccttc cggaccaggg ggacaatgac aattggtgga caggatggag acaatggata
7981 ccggcaggta ttggagttac aggcgttata attgcagtta tcgctttatt ctgtatatgc
8041 aaatttgtct tttagttttt cttcagattg cttcatggca aagctcagcc tcaaatcaat
8101 gaaaccagga tttaattata tggattactt gaatctaaga ttacttgaca aatgataata
8161 taatacactg gagctttaaa catagccaat gtgattctaa ctcttttaaa ctcacagtta
8221 atcataaata aggtttgaca tcaatctagt tatctctttg agaatgataa acttgatgaa
8281 gattaagaaa aaggtaatct ttcgattatc tttaatcttc atccttgatt ctacaatcat
8341 gacagttgtc tttagtgaca agggaaagaa gcctttttat taagttgtaa taatcagatc
8401 tgcgaaccgg tagagtttag ttgcaaccta acacacataa agcattgatc aaaaagtcaa
8461 tagaaattta aacagtgagt ggagacaact tttaaatgga agcttcatat gagagaggac
8521 gcccacgagc tgccagacag cattcaaggg atggacacga ccaccatgtt cgagcacgat
8581 catcatccag agagaattat cgaggtgagt accgtcaatc aaggagcgcc tcacaagtgc
8641 gcgttcctac tgtatttcat aagaagagag ttgaaccatt aacagttcct ccagcaccta
8701 aagacatatg tccgaccttg aaaaaaggat ttttgtgtga cagtagtttt tgcaaaaaag
8761 atcaccagtt ggagagttta actgataggg aattactcct actaatcgcc cgtaagactt
8821 gtggatcagt agaacaacaa ttaaatataa ctgcacccaa ggactcgcgc ttagcaaatc
8881 caacggctga tgatttccag caagaggaag gtccaaaaat taccttgttg actctgatca
8941 agacggcaga acactgggcg agacaagaca tcagaaccat agaggattca aaattaagag
9001 cattgttgac tctatgtgct gtgatgacga ggaaattctc aaaatcccag ctgagtcttt
9061 tatgtgagac acacctaagg cgtgaggggc ttgggcaaga tcaggcagaa cctgttctcg
9121 aagtatatca acgattacac agtgataaag gaggcagttt tgaagctgca ctatggcaac
9181 aatgggaccg acaatcccta attatgttta tcactgcatt cttgaatatc gctctccagt
9241 taccgtgtga aagttctgct gtcgttgttt cagggttaag aacattggtt cctcaatcag
9301 ataatgagga agcttcaacc aacccgggga catgctcatg gtctgatgag ggtacccctt
9361 aataaggctg actaaaacac tatataacct tctacttgat cacaatactc cgtataccta
9421 ttatcatata tttaatcaag acgatatcct ttaagactta ttcagtacta taatcactct
9481 cgtttcaaat taataagatg tgcatgattg ccctaatata tgaagaggta tgatacaacc
9541 ctaacagtga ccaaagaaaa tcataatctc gtatcgctcg taatataacc tgccaagcat
9601 acctcttgca caaagtgatt cttgtacaca aataatgttt taccctacag gaggtagcaa
9661 cgatccatcc catcaaaaaa taagtatttt atgacttact aatgacctct taaaatatta
9721 agaaaaactg acggaacata aattctttct gcttcaagtt gtggaggagg tgtttggtat
9781 tggctattgt tatattacaa tcaataacaa gcttgtaaaa atattgttct tgtttcaaga
9841 ggtagattgt ggctggaaat gctaaactaa tgatgaagat taatgcggag gtctgataag
9901 aataaacctt attattcaga ttaggcccca agaggcattc ttcatctcct tttagcaaag
9961 tactatttca gggtagtcca attagtgaca cgtctcttag ctgtatatca gtcgcccctg
10021 agatacgcca caaaagtgtc tctaagctaa attggtctgt acacatctca tacattgtat
10081 tagggacaat aatatctaat tgaacttagc cgtttaaaat ttagtgcata aatctgggct
10141 aactccacca ggtcaactcc attggctgaa aagaagccta cctacaacga acatcacttt
10201 gagcgccctc acatttaaaa aataggaacg tcgttccaac aatcgagcgc aaggtttcaa
10261 ggttgaactg agagtgtcta gacaacaaag tatcgatcct ccagacacca agcaagacct
10321 gagaaaaaac catggctaaa gctacgggac gatacaatct aatatcgccc aaaaaggacc
10381 tggagaaagg ggttgtctta agcgacctct gtaacttctt agttagccaa actattcagg
10441 ggtggaaggt ttattgggct ggtattgagt ttgatgtgac tcacaaagga atggccctat
10501 tgcaaagact gaaaactaat gactttgccc ctgcatggtc aatgacaagg aatctctttc
10561 ctcatttatt tcaaaatccg aattccacaa ttgaatcacc gctgtgggca ttgagagtca
10621 tccttgcagc agggatacaa gaccagctga ttgaccagtc tttgattgaa cccttagcag
10681 gagcccttgg tctgatctct gattggctgc taacaaccaa cactaaccat ttcaacatgc
10741 gaacacaacg tgtcaaggaa caattgagcc taaaaatgct gtcgttgatt cgatccaata
10801 ttctcaagtt tattaacaga ttggatgctc tacatgtcgt gaactacaac ggattgttga
10861 gcagtattga aattggaact caaaatcata caatcatcat aactcgaact aacatgggtt
10921 ttctggtgga gctccaagaa cccgacaaat cggcaatgaa ccgcaagaag cctgggccgg
10981 cgaaattttc cctccttcat gagtccacac tgaaagcatt tacacaagga tcctcaacac
11041 gaatgcaaag tttgattctt gaatttaata gctctcttgc tatctaacta agatggaata
11101 cttcatattg agctaactca tatatgctga ctcaatagtt atcttgacat ctctgctttc
11161 ataatcagat atataagcat aataaataaa tacgcatatt tcttgataat ttgtttaacc
11221 acagataaat cctcactgta agccagcttc caagttgaca cccttacaaa aaccaggact
11281 cagaatccct caaataagag attccaagac aacatcatag aattgcttta tcatatgaat
11341 aagcatttta tcaccagaaa tcttatatac taaatggtta attgtaactg aacccgcagg
11401 tcacatgtgt taggtttcac agattttata tattactaac tctatactcg taattaacat
11461 tagataagta gattaagaaa aaagcctgag gaagattaag aaaaactgct tattgggtct
11521 ttccgtgttt tagatgaagc agttgaaatt cttcctcttg atattaaatg gctacacaac
11581 atacccaata cccggacgct aggttatcat caccaattgt attggaccaa tgtgacctag
11641 tcactagagc ttgcgggtta tattcatcat actcccttaa tccgcaacta cgcaactgta
11701 aactcccgaa acatatctac cgtttgaaat acgatgtaac tgttaccaag ttcttgagtg
11761 atgtaccagt ggcgacattg cccatagatt tcatagtccc aattcttctc aaggcactgt
11821 caggcaatgg gttctgtcct gttgagccgc ggtgccaaca gttcttagat gaaatcatta
11881 agtacacaat gcaagatgct ctcttcttga aatattatct caaaaatgtg ggtgctcaag
11941 aagactgtgt tgatgaccac tttcaagaga aaatcttatc ttcaattcag ggcaatgaat
12001 ttttacatca aatgtttttc tggtatgatc tggctatttt aactcgaagg ggtagattaa
12061 atcgaggaaa ctctagatca acatggtttg ttcatgatga tttaatagac atcttaggtt
12121 atggggacta tgttttttgg aagatcccaa tttcaatgtt accactgaac acacaaggaa
12181 tcccccatgc tgctatggac tggtatcagg catcagtatt caaagaagcg gttcaagggc
12241 atacacacat tgtttctgtt tctactgccg acgtcttgat aatgtgcaaa gatttaatta
12301 catgtcgatt caacacaact ctaatctcaa aaatagcaga gattgaggat ccagtttgtt
12361 ctgattatcc caattttaag attgtgtcta tgctttacca gagcggagat tacttactct
12421 ccatattagg gtctgatggg tataaaatta ttaagttcct cgaaccattg tgcttggcca
12481 aaattcaatt atgctcaaag tacaccgaga ggaagggccg attcttaaca caaatgcatt
12541 tagctgtaaa tcacacccta gaagaaatta cagaaatgcg tgcactaaag ccttcacagg
12601 ctcaaaagat ccgtgaattc catagaacat tgataaggct ggagatgacg ccacaacagc
12661 tttgtgagct attttccatt caaaaacact gggggcatcc tgtgctacat agtgaaacag
12721 caatccaaaa agttaaaaaa catgctacgg tgctaaaagc attacgccct atagtgattt
12781 tcgagacata ctgtgttttt aaatatagta ttgccaaaca ttattttgat agtcaagggt
12841 cttggtacag tgttacttca gataggaatc taacaccagg tcttaattct tatatcaaaa
12901 gaaatcaatt ccctccgttg ccaatgatta aagaactact atgggaattt taccaccttg
12961 accatcctcc acttttctca accaaaatta ttagtgactt aagtattttt ataaaagaca
13021 gagctactgc agtagaaagg acatgctggg atgcagtatt cgagcctaat gttctaggat
13081 ataatccacc tcacaaattt agtactaaac gtgtaccgga acaattttta gagcaagaaa
13141 acttttctat tgagaatgtt ctttcctacg cgcaaaaact cgagtatcta ctaccacaat
13201 atcggaactt ttctttctca ttgaaagaga aagagttgaa tgtaggtaga accttcggaa
13261 aattgcctta tccgactcgc aatgttcaaa cactttgtga agctctgtta gctgatggtc
13321 ttgctaaagc atttcctagc aatatgatgg tagttacgga acgtgagcaa aaagaaagct
13381 tattgcatca agcatcatgg caccacacaa gtgatgattt tggtgaacat gccacagtta
13441 gagggagtag ctttgtaact gatttagaga aatacaatct tgcatttaga tatgagttta
13501 cagcaccttt tatagaatat tgcaaccgtt gctatggtgt taagaatgtt tttaattgga
13561 tgcattatac aatcccacag tgttatatgc atgtcagtga ttattataat ccaccacata
13621 acctcacact ggaaaatcga gacaaccccc ccgaagggcc tagttcatac aggggtcata
13681 tgggagggat tgaaggactg caacaaaaac tctggacaag tatttcatgt gctcaaattt
13741 ctttagttga aattaagact ggttttaagt tacgctcagc tgtgatgggt gacaatcagt
13801 gcattaccgt tttatcagtc ttccccttag agactgacgc agacgagcag gaacagagcg
13861 ccgaagacaa tgcagcgagg gtggccgcta gcctagcaaa agttacaagt gcctgtggaa
13921 tctttttaaa acctgatgaa acatttgtac attcaggttt tatctatttt ggaaaaaaac
13981 aatatttgaa tggggtccaa ttgcctcagt cccttaaaac ggctacaaga atggcaccat
14041 tgtctgatgc aatttttgat gatcttcaag ggaccctagc tagtataggc actgcttttg
14101 agcgatccat ctctgagaca cgacatatct ttccttgcag gataaccgca gctttccata
14161 cgtttttttc ggtgagaatc ttgcaatatc atcatctcgg gttcaataaa ggttttgacc
14221 ttggacagtt aacactcggt aaacctctgg atttcggaac aatatcattg gcactagcgg
14281 taccgcaggt gcttggagga ttatccttct tgaatcctga gaaatgtttc taccggaatc
14341 taggagatcc agttacctca ggtttattcc agttaaaaac ttatctccga atgattgaga
14401 tggatgattt attcttacct ttaattgcaa agaaccctgg gaactgcact gccattgact
14461 ttgtgctaaa tcctagcgga ttaaatgtcc ctgggtcgca agacttaact tcatttctgc
14521 gccagattgt acgcaggacc atcaccctaa gtgcgaaaaa caaacttatt aataccttat
14581 ttcatgcgtc agctgacttc gaagacgaaa tggtttgtaa atggctatta tcatcaactc
14641 ctgttatgag tcgttttgcg gccgatatct tttcacgcac gccgagcggg aagcgattgc
14701 aaattctagg atacctggaa ggaacacgca cattattagc ctctaggatc atcaacaata
14761 atacagagac accggttttg gacagactga ggaaaataac attgcaaagg tggagtctgt
14821 ggtttagtta tcttgatcat tgtgataata tcctggcgga ggctttaacc caaataactt
14881 gcacagttga tttagcacag atcctgaggg aatattcatg ggctcatatt ttagagggaa
14941 gacctcttat tggagccaca ctcccatgta tgattgagca attcaaagtg ttttggctga
15001 aaccctacga acaatgtccg cagtgttcaa atgcaaagca accaggtggg aaaccattcg
15061 tgtcagtggc agtcaagaaa catattgtta gtgcatggcc taacgcatcc cgactaagct
15121 ggactatcgg ggatggaatc ccttacattg gatcaaggac agaagataag ataggacaac
15181 ctgctattaa accaaaatgt ccttccgcag ccttaagaga ggccattgaa ttggcgtccc
15241 gtttaacatg ggtaactcaa ggcagttcga acagtgactt gctaataaag ccatttttgg
15301 aagcacgagt aaatttaagt gttcaagaaa tacttcaaat gaccccttca cattactcag
15361 gaaatattgt tcacaggtac aacgatcaat acagtcctca ttctttcatg gccaatcgta
15421 tgagtaattc agcaacgcga ttgattgttt ctacaaacac tttaggtgag ttttcaggag
15481 gtggccagtc tgcacgcgac agcaatatta ttttccagaa tgttataaat tatgcagttg
15541 cactgttcga tattaaattt agaaacactg aggctacaga tatccaatat aatcgtgctc
15601 accttcatct aactaagtgt tgcacccggg aagtaccagc tcagtattta acatacacat
15661 ctacattgga tttagattta acaagatacc gagaaaacga attgatttat gacaataatc
15721 ctctaaaagg aggactcaat tgcaatatct cattcgataa cccatttttc caaggtaaac
15781 agctgaacat tatagaagat gatcttattc gactgcctca cttatctgga tgggagctag
15841 ccaagaccat catgcaatca attatttcag atagcaacaa ttcatctaca gacccaatta
15901 gcagtggaga aacaagatca ttcactaccc atttcttaac ttatcccaag ataggacttc
15961 tgtacagttt tggggccttt gtaagttatt atcttggcaa tacaattctt cggactaaga
16021 aattgacact tgacaatttt ttatattact taactaccca aattcataat ctaccacatc
16081 gctcattgcg aatacttaag ccaacattca aacatgcaag cgttatgtca cggttaatga
16141 gtattgatcc tcatttttct atttacatag gcggtgctgc aggtgacaga ggactctcag
16201 atgcggccag gttatttttg agaacgtcta tttcatcttt tcttacattt gtaaaagaat
16261 ggataattaa tcgcggaaca attgtccctt tatggatagt atatccgcta gagggtcaaa
16321 acccaacacc tgttaataat tttctctatc agatcgtaga actgctggtg catgattcat
16381 caagacaaca ggctttaaaa actaccataa gtgatcatgt acatcctcac gacaatcttg
16441 tttacacatg taagagtaca gccagcaatt tcttccatgc atcattggcg tactggagga
16501 gcaggcacag aaacagcaac cgaaaatact tggcaagaga ctcttcaact agatcaagca
16561 caaacaacag tgatggtcat attgagagaa gtcaagaaca aaccaccaga gatccacatg
16621 atggcactga acggaatcta gttctacaaa tgagccatga aataaaaaga acgacaattc
16681 cacaagaaaa cacgcaccag ggtccgtcgt tccagtcctt tctaagttac tctgcttgtg
16741 gtacagcaaa tccaaaacta aatttcgatc gatcgagaca caatgtgaaa tctcaggatc
16801 ataactcggc atccaagagg gaaggtcatc aaataatctc acaccgtcta gtcctacctt
16861 tctttacatt atctcaaggg acacgccaat taacgtcatc taatgagtca cagacccaag
16921 acgagatatc aaagtactta cggcaattga gatccgtcat tgataccaca gtttattgta
16981 ggtttaccgg tatagtctcg tccatgcatt acaaacttga tgaggtcctt tgggaaatag
17041 agagttttaa gtcggctgtg acgctagcag agggagaagg tgctggtgcc ttactattga
17101 ttcagaaata ccaagttaag accttatttt tcaacacgct agctactgag tccagtatag
17161 agtcagaaat agtatcagga atgactactc ctaggatgct tctacctgtt atgtcaaaat
17221 tccataatga ccaaattgag attattctta acaactcagc aagccaaata acagacataa
17281 caaatcctac ttggtttaaa gaccaaagag caaggctacc taagcaagtc gaggttataa
17341 ccatggatgc agagacgaca gagaatataa acagatcgaa attgtacgaa gctgtatata
17401 aactgatctt acaccatatt gatcccagcg tattgaaagc agtggtcctt aaagtcttcc
17461 taagtgatac tgagggtatg ttatggctaa atgataattt agccccgttt tttgccactg
17521 gttatttaat taagccaata acgtcaagtg ctagatctag tgagtggtat ctttgtctga
17581 cgaacttctt atcaactaca cgaaagatgc cacaccaaaa ccatctcagt tgtaaacagg
17641 taatacttac ggcattgcaa ctgcaaattc aacggagccc atactggcta agtcatttaa
17701 ctcagtatgc tgactgtgat ttacatttaa gttatatccg ccttggtttt ccatcattag
17761 agaaagtact ataccacagg tataacctcg tcgattcaaa aagaggtcca ctagtctcta
17821 tcactcagca cttagcacat cttagagcag agattcgaga attaactaat gattataatc
17881 aacagcgaca aagtcgaact caaacatatc actttattcg tactgcaaaa ggacgaatca
17941 caaaactagt caatgattat ttaaaattct ttcttattgt gcaagcatta aaacataatg
18001 ggacatggca agctgagttt aagaaattac cagagttgat tagtgtgtgc aataggttct
18061 accatattag agattgcaat tgtgaagaac gtttcttagt tcaaacctta tatttacata
18121 gaatgcagga ttctgaagtt aagcttatcg aaaggctgac agggcttctg agtttatttc
18181 cggatggtct ctacaggttt gattgaatta ccgtgcatag tatcctgata cttgcaaagg
18241 ttggttatca acatacagat tataaaaaac tcataaattg ctctcataca tcatattgat
18301 ctgatttcaa taaacaacta tttaaataac gaaaggagtc cctatattat acactatatt
18361 tagcctctct ccctgcgtga taatcaaaaa attcacaatg cagcatgtgt gacatattaa
18421 tgccgcaatg aatttaacgc aacataataa actctgcact ctttataatt aagctttaac
18481 gaaaggtctg ggctcatatt gttattgata taataatgtt atatcaatgt cctgtcagat
18541 ggaatagtgt tttggttgat aacacgactt cttaaaacaa aattgatctt taagattaag
18601 ttttttataa ttatcattac tttaatttat cgatttgaaa atggtaatag ccttaatctt
18661 tgtgtaaaat aagagattag gtgtaataac tttaacattt ttgtctagta agttactatt
18721 tcatacagaa tgataaaatt aaaagaaaag gcaggactgt aaaatcataa ataccttctt
18781 tacaatatag cagactagat aataatcttt gtgttaatga taattaagac attgaccacg
18841 ctcatcagaa ggctcgccaa aataaacgtt gcaaaaagga ttcctggaaa aatggtcgca
18901 cacaaaaatt taaaaataaa tctatttctt cttttttgtg ttcc

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Sep 01, 2014 11:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Select seq gb|JQ352763.1| Zaire ebolavirus strain Kikwit, complete genome 34158 34158 100% 0.0 100% JQ352763.1
Select seq gb|AY354458.1| Zaire ebolavirus strain Zaire 1995, complete genome 34148 34148 99% 0.0 99% AY354458.1
Select seq gb|KC242799.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/1995/13709 Kikwit, complete genome 34113 34113 99% 0.0 99% KC242799.1
Select seq gb|KC242796.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/1995/13625 Kikwit, complete genome 34108 34108 99% 0.0 99% KC242796.1
Select seq gb|KC242792.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1994/Gabon, complete genome 33332 33332 99% 0.0 99% KC242792.1
Select seq gb|KC242793.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1996/1Eko, complete genome 33302 33302 99% 0.0 99% KC242793.1
Select seq gb|KC242795.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1996/1Mbie, complete genome 33302 33302 99% 0.0 99% KC242795.1
Select seq gb|KC242794.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1996/2Nza, complete genome 33275 33275 99% 0.0 99% KC242794.1
Select seq gb|KC242798.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1996/1Ikot, complete genome 33275 33275 99% 0.0 99% KC242798.1
Select seq gb|AY142960.1| Zaire Ebola virus strain Mayinga subtype Zaire, complete genome 33149 33149 99% 0.0 99% AY142960.1
Select seq gb|KC242801.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/1976/deRoover, complete genome 33143 33143 99% 0.0 99% KC242801.1
Select seq gb|KC242791.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/1977/Bonduni, complete genome 33143 33143 99% 0.0 99% KC242791.1
Select seq gb|AF086833.2| Ebola virus - Mayinga, Zaire, 1976, complete genome 33143 33143 99% 0.0 99% AF086833.2
Select seq gb|KF827427.1| Mutant Zaire ebolavirus, complete sequence 33125 33125 99% 0.0 99% KF827427.1
Select seq gb|AF272001.1| Zaire Ebola virus strain Mayinga, complete genome 33103 33103 99% 0.0 99% AF272001.1
Select seq gb|AF499101.1| Zaire Ebola virus strain Mayinga, complete genome 33093 33093 99% 0.0 99% AF499101.1
Select seq gb|EU224440.2| Zaire ebolavirus strain Mayinga, complete genome 33085 33085 99% 0.0 99% EU224440.2
Select seq gb|KC242786.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/1 Luebo, complete genome 32319 32319 99% 0.0 98% KC242786.1
Select seq gb|KC242787.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/23 Luebo, complete genome 32315 32315 99% 0.0 98% KC242787.1
Select seq gb|KC242790.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/5 Luebo, complete genome 32306 32306 99% 0.0 98% KC242790.1
Select seq gb|KC242789.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/4 Luebo, complete genome 32306 32306 99% 0.0 98% KC242789.1
Select seq gb|KC242785.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/0 Luebo, complete genome 32301 32301 99% 0.0 98% KC242785.1
Select seq gb|KC242784.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/9 Luebo, complete genome 32301 32301 99% 0.0 98% KC242784.1
Select seq gb|KC242788.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/COD/2007/43 Luebo, complete genome 32279 32279 99% 0.0 98% KC242788.1
Select seq gb|HQ613403.1| Zaire ebolavirus isolate M-M, partial genome 32085 32085 99% 0.0 98% HQ613403.1
Select seq gb|KC242800.1| Zaire ebolavirus isolate EBOV/H.sapiens-tc/GAB/1996/Ilembe, complete genome 32066 32066 99% 0.0 98% KC242800.1
Select seq gb|HQ613402.1| Zaire ebolavirus isolate 034-KS, partial genome 31984 31984 99% 0.0 98% HQ613402.1
Select seq gb|KJ660346.1| Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Kissidougou-C15, complete genome 31511 31511 99% 0.0 97% KJ660346.1
Select seq gb|KJ660347.1| Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Gueckedou-C07, complete genome 31507 31507 99% 0.0 97% KJ660347.1
Select seq gb|KJ660348.1| Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Gueckedou-C05, complete genome 31498 31498 99% 0.0 97% KJ660348.1
Select seq gb|KM034555.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3676.2, partial genome 31484 31484 99% 0.0 97% KM034555.1
Select seq gb|KM034554.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3676.1, partial genome 31484 31484 99% 0.0 97% KM034554.1
Select seq gb|KM034562.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3686.1, partial genome 31475 31475 99% 0.0 97% KM034562.1
Select seq gb|KM233072.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3782, partial genome 31466 31466 99% 0.0 97% KM233072.1
Select seq gb|KM233054.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3729, partial genome 31466 31466 99% 0.0 97% KM233054.1
Select seq gb|KM034560.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3682.1, partial genome 31466 31466 99% 0.0 97% KM034560.1
Select seq gb|KM034557.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3677.2, partial genome 31466 31466 99% 0.0 97% KM034557.1
Select seq gb|KM233106.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3840, partial genome 31462 31462 99% 0.0 97% KM233106.1
Select seq gb|KM233097.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3823, partial genome 31462 31462 99% 0.0 97% KM233097.1
Select seq gb|KM233080.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3799, partial genome 31462 31462 99% 0.0 97% KM233080.1
Select seq gb|KM233063.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3764, partial genome 31462 31462 99% 0.0 97% KM233063.1
Select seq gb|KM233057.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3735.2, partial genome 31462 31462 99% 0.0 97% KM233057.1
Select seq gb|KM233056.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3735.1, partial genome 31462 31462 99% 0.0 97% KM233056.1
Select seq gb|KM233049.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3707, partial genome 31462 31462 99% 0.0 97% KM233049.1
Select seq gb|KM233039.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM112, partial genome 31462 31462 99% 0.0 97% KM233039.1
Select seq gb|KM233113.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3856.1, partial genome 31457 31457 99% 0.0 97% KM233113.1
Select seq gb|KM233110.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3848, partial genome 31457 31457 99% 0.0 97% KM233110.1
Select seq gb|KM233103.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3831, partial genome 31457 31457 99% 0.0 97% KM233103.1
Select seq gb|KM233099.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3825.2, partial genome 31457 31457 99% 0.0 97% KM233099.1
Select seq gb|KM233098.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3825.1, partial genome 31457 31457 99% 0.0 97% KM233098.1
Select seq gb|KM233096.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3822, partial genome 31457 31457 99% 0.0 97% KM233096.1
Select seq gb|KM233062.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3758, partial genome 31457 31457 99% 0.0 97% KM233062.1
Select seq gb|KM233053.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3724, partial genome 31457 31457 99% 0.0 97% KM233053.1
Select seq gb|KM233051.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3713.3, partial genome 31457 31457 99% 0.0 97% KM233051.1
Select seq gb|KM233050.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3713.2, partial genome 31457 31457 99% 0.0 97% KM233050.1
Select seq gb|KM233052.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3713.4, partial genome 31455 31455 99% 0.0 97% KM233052.1
Select seq gb|KM233109.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3846, partial genome 31453 31453 99% 0.0 97% KM233109.1
Select seq gb|KM233102.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3829, partial genome 31453 31453 99% 0.0 97% KM233102.1
Select seq gb|KM233092.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3818, partial genome 31453 31453 99% 0.0 97% KM233092.1
Select seq gb|KM233070.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3770.2, partial genome 31453 31453 99% 0.0 97% KM233070.1
Select seq gb|KM233069.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3770.1, partial genome 31453 31453 99% 0.0 97% KM233069.1
Select seq gb|KM034559.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3680.1, partial genome 31453 31453 99% 0.0 97% KM034559.1
Select seq gb|KM233114.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3856.3, partial genome 31452 31452 99% 0.0 97% KM233114.1
Select seq gb|KM034556.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3677.1, partial genome 31448 31448 99% 0.0 97% KM034556.1
Select seq gb|KM233075.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3788, partial genome 31443 31443 99% 0.0 97% KM233075.1
Select seq gb|KM034551.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM096, partial genome 31441 31441 99% 0.0 97% KM034551.1
Select seq gb|KM233100.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3826, partial genome 31439 31439 99% 0.0 97% KM233100.1
Select seq gb|KM233081.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3800, partial genome 31439 31439 99% 0.0 97% KM233081.1
Select seq gb|KM233116.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-NM042.1, partial genome 31435 31435 99% 0.0 97% KM233116.1
Select seq gb|KM233084.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3807, partial genome 31432 31432 99% 0.0 97% KM233084.1
Select seq gb|KM034553.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3670.1, partial genome 31432 31432 99% 0.0 97% KM034553.1
Select seq gb|KM233065.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3769.1, partial genome 31430 31430 99% 0.0 97% KM233065.1
Select seq gb|KM233040.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM113, partial genome 31428 31428 99% 0.0 97% KM233040.1
Select seq gb|KM233047.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM124.3, partial genome 31426 31426 99% 0.0 97% KM233047.1
Select seq gb|KM034561.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3683.1, partial genome 31424 31424 99% 0.0 97% KM034561.1
Select seq gb|KM233112.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3851, partial genome 31423 31423 99% 0.0 97% KM233112.1
Select seq gb|KM233088.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3810.2, partial genome 31423 31423 99% 0.0 97% KM233088.1
Select seq gb|KM034558.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3679.1, partial genome 31423 31423 99% 0.0 97% KM034558.1
Select seq gb|KM233105.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3838, partial genome 31415 31415 99% 0.0 97% KM233105.1
Select seq gb|KM233073.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3786, partial genome 31415 31415 99% 0.0 97% KM233073.1
Select seq gb|KM233044.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM121, partial genome 31410 31410 99% 0.0 97% KM233044.1
Select seq gb|KM233038.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM111, partial genome 31410 31410 99% 0.0 97% KM233038.1
Select seq gb|KM233037.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM110, partial genome 31410 31410 99% 0.0 97% KM233037.1
Select seq gb|KM233035.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM104, partial genome 31406 31406 99% 0.0 97% KM233035.1
Select seq gb|KM233067.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3769.3, partial genome 31403 31403 99% 0.0 97% KM233067.1
Select seq gb|KM233045.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM124.1, partial genome 31403 31403 99% 0.0 97% KM233045.1
Select seq gb|KM233043.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM120, partial genome 31403 31403 99% 0.0 97% KM233043.1
Select seq gb|KM233042.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM119, partial genome 31401 31401 99% 0.0 97% KM233042.1
Select seq gb|KM233104.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3834, partial genome 31397 31397 99% 0.0 97% KM233104.1
Select seq gb|KM233089.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3814, partial genome 31397 31397 99% 0.0 97% KM233089.1
Select seq gb|KM233071.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3771, partial genome 31390 31390 99% 0.0 97% KM233071.1
Select seq gb|KM233077.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3795, partial genome 31388 31388 99% 0.0 97% KM233077.1
Select seq gb|KM233074.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3787, partial genome 31370 31370 99% 0.0 97% KM233074.1
Select seq gb|KM233061.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3752, partial genome 31370 31370 99% 0.0 97% KM233061.1
Select seq gb|KM233041.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM115, partial genome 31367 31367 99% 0.0 97% KM233041.1
Select seq gb|KM233085.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3808, partial genome 31365 31365 99% 0.0 97% KM233085.1
Select seq gb|KM233055.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3734.1, partial genome 31358 31358 99% 0.0 97% KM233055.1
Select seq gb|KM034550.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM095, partial genome 31356 31356 99% 0.0 97% KM034550.1
Select seq gb|KM233107.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3841, partial genome 31354 31354 99% 0.0 97% KM233107.1
Select seq gb|KM233091.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3817, partial genome 31354 31354 99% 0.0 97% KM233091.1
Select seq gb|KM233093.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3819, partial genome 31352 31352 99% 0.0 97% KM233093.1
Select seq gb|KM233101.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3827, partial genome 31345 31345 99% 0.0 97% KM233101.1
Select seq gb|KM233066.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3769.2, partial genome 31345 31345 99% 0.0 97% KM233066.1
Select seq gb|KM233036.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM106, partial genome 31343 31343 99% 0.0 97% KM233036.1
Select seq gb|KM233079.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3798, partial genome 31338 31338 99% 0.0 97% KM233079.1
Select seq gb|KM233046.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM124.2, partial genome 31333 31333 99% 0.0 97% KM233046.1
Select seq gb|KM233095.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3821, partial genome 31320 31320 99% 0.0 97% KM233095.1
Select seq gb|KM233087.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3810.1, partial genome 31314 31314 99% 0.0 97% KM233087.1
Select seq gb|KM233058.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3750.1, partial genome 31298 31298 99% 0.0 97% KM233058.1
Select seq gb|KM233115.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3857, partial genome 31275 31275 99% 0.0 97% KM233115.1
Select seq gb|KM233086.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3809, partial genome 31266 31266 99% 0.0 97% KM233086.1
Select seq gb|KM233048.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM124.4, partial genome 31264 31264 99% 0.0 97% KM233048.1
Select seq gb|KM233076.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3789.1, partial genome 31250 31250 99% 0.0 97% KM233076.1
Select seq gb|KM233082.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3805.1, partial genome 31239 31239 99% 0.0 97% KM233082.1
Select seq gb|KM233064.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3765.2, partial genome 31235 31235 99% 0.0 97% KM233064.1
Select seq gb|KM233090.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3816, partial genome 31206 31206 99% 0.0 97% KM233090.1
Select seq gb|KM233059.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3750.2, partial genome 31206 31206 99% 0.0 97% KM233059.1
Select seq gb|KM034549.1| Zaire ebolavirus isolate H.sapiens-wt/SLE/2014/ManoRiver-EM095B, partial genome 31192 31192 99% 0.0 97% KM034549.1
Select seq gb|KM233083.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3805.2, partial genome 31168 31168 99% 0.0 97% KM233083.1
Select seq gb|KM034552.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-EM098, partial genome 31165 31165 99% 0.0 97% KM034552.1
Select seq gb|KM233111.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3850, partial genome 31141 31141 98% 0.0 97% KM233111.1
Select seq gb|KM233060.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-G3750.3, partial genome 31075 31075 98% 0.0 97% KM233060.1
Select seq gb|KM233117.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-NM042.2, partial genome 31037 31037 98% 0.0 97% KM233117.1
Select seq gb|KM233118.1| Zaire ebolavirus isolate Ebola virus H.sapiens-wt/SLE/2014/ManoRiver-NM042.3, partial genome 30923 30923 98% 0.0 97% KM233118.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 02, 2014 11:40 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Virological analysis: no link between Ebola outbreaks in west Africa and Democratic Republic of Congo

Situation assessment - 2 September 2014

Results from virus sequencing of samples from the Ebola outbreak in the Democratic Republic of Congo (DRC) were received last night. The virus is the Zaire strain, in a lineage most closely related to a virus from the 1995 Ebola outbreak in Kikwit, DRC.

The Zaire strain of the virus is indigenous in the country. Ebola first emerged in 1976 in almost simultaneous outbreaks in the Democratic Republic of Congo (then Zaire) and South Sudan (then Sudan).

Confirmatory testing was done at Gabon’s Centre International de Recherches Médicales in Franceville, a WHO collaborating centre. Earlier, testing in DRC confirmed Ebola in 6 of 8 samples.

The outbreak is located in the remote Boende district, Equateur province in the north-western part of the country.

Results from virus characterization, together with findings from the epidemiological investigation, are definitive: the outbreak in DRC is a distinct and independent event, with no relationship to the outbreak in west Africa.

As the Gabon laboratory report clearly stated, “the virus in the Boende district is definitely not derived from the virus strain currently circulating in west Africa.”

These findings are reassuring, as they exclude the possibility that the virus has spread from West to Central Africa.

Epidemiological investigation has linked the index case, who died on 11 August, to the preparation of bushmeat for consumption.

This is the country’s seventh Ebola outbreak since 1976. The introduction of the virus into the human population following contact with infected bushmeat (usually fruit bats or monkeys) is consistent with the pattern seen at the start of previous outbreaks. The virus is now spreading from person to person.

The response team has, to date, identified 53 cases consistent with the case definition for Ebola virus disease, including 31 deaths. Seven of these deaths were among health care workers. More than 160 contacts are being traced.

The government has rapidly mounted a robust response by reactivating emergency committees at national, provincial, and local levels, setting up isolation centres, and providing community leaders with facts about the disease. The government will ensure that all burials are safe.

The WHO team confirmed that collaboration between the government and its key partners is excellent.

The outbreak zone, where the most intense transmission is occurring, is remote, located some 1200 kilometres from the capital city, Kinshasa. No paved roads run from the outbreak zone to Kinshasa. However, cases have been detected or transmission is ongoing at three sites, underscoring the need to watch the outbreak’s evolution closely.

Motorcycles, canoes, and satellite phones have been supplied to facilitate outbreak investigation and contact tracing. A dedicated helicopter will be made available soon.

WHO media contacts:
Fadéla Chaib
Telephone: + 41 22 791 3228
Mobile:+ 41 79 475 55 56
Email: chaibf@who.int

Tarik Jasarevic
Mobile: +41 793 676 214
Tel: +41 22 791 5099
E-mail: jasarevict@who.int

http://www.who.int/mediacentre/news/ebo ... r-2014/en/

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 02, 2014 7:51 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Congo outbreak of Ebola unrelated to escalating West African epidemic



Kai is a contributing correspondent for Science magazine based in Berlin, Germany.

Email Kai


Martin is a contributing news editor and writer based in Amsterdam

Email Martin


Jon is a staff writer for Science.

Email Jon
By Kai Kupferschmidt Martin Enserink Jon Cohen 2 September 2014 7:15 pm Comments
A new Ebola outbreak in the Democratic Republic of the Congo (DRC) is unrelated to the 6-month-old epidemic in West Africa, a genetic analysis has confirmed. Although the virus belongs to the same species, Ebola-Zaire, the strain is genetically so different that it "is definitely not a dissemination of the outbreak in West Africa,” says virologist Eric Leroy of the International Centre for Medical Research of Franceville, the World Health Organization collaborating center in Gabon that is characterizing the DRC virus.

Meanwhile, WHO and Doctors Without Borders (MSF) today issued fresh and even more urgent calls for immediate, massive international action to contain the West African outbreak, which is spiraling out of control. At a United Nations briefing today, MSF's Joanne Liu painted a particularly desperate picture of the situation on the ground.

"Ebola treatment centers are reduced to places where people go to die alone, where little more than palliative care is offered," Liu said. "It is impossible to keep up with the sheer number of infected people pouring into facilities. In Sierra Leone, infectious bodies are rotting in the streets. Rather than building new Ebola care centers in Liberia, we are forced to build crematoria."

At the same briefing, WHO Director-General Margaret Chan raised her fist and called for "Action, action, action!"

The DRC outbreak, first reported to WHO on 26 August, has so far sickened 53 people and killed 31, according to WHO. Early test results suggested the two outbreaks were caused by two different species of Ebola. (There are five species of Ebola virus, three of which cause outbreaks in humans: Zaire, Sudan, and Bundibugyo.) But the DRC outbreak, like the one in West Africa, turned out to be Zaire, Leroy wrote to ScienceInsider in an e-mail over the weekend.

Now, a sequence of 346 base pairs of one of the virus's genes has shown that the two outbreaks aren't directly related. The fragment has seven mutations compared with genomes from the current outbreak in Guinea, but only four mutations compared with the strain that caused the first known Ebola outbreak in 1976, also in the DRC, which was then named Zaire. It is even more closely related—by just three mutations—to the strain that caused an outbreak in the DRC city of Kikwit in 1995. Leroy says he hopes to have a full genome sequence of the new DRC strain by the end of this week.

An epidemiological investigation hadn't suggested any links between the two outbreaks either. The index case in the DRC is believed to have been a pregnant woman from Ikanamongo Village in the north of the country, who prepared bush meat hunted by her husband.

The outbreak zone in the DRC is in a remote area approximately 1200 kilometers north of Kinshasa. "Motorcycles, canoes, and satellite phones have been supplied to facilitate outbreak investigation and contact tracing,” a statement issued today by WHO noted. "A dedicated helicopter will be made available soon.”

That remoteness makes the response more difficult—but it's also reason to be confident that this outbreak can be contained, Leroy says, because infected people won't travel as much as they do in West Africa. In addition, he says, "the DRC has much experience with Ebola outbreaks, so all the people know very well what to do to stop the outbreak.”

In West Africa, meanwhile, the outbreak shows no signs of slowing down. If it continues to accelerate at the current pace, the virus could sicken more than 10,000 people by 24 September, according to scientists trying to predict the spread of the virus.

Public health experts are sounding increasingly alarmed. "There is a window of opportunity to tamp this down, but that window is closing. We need action now to scale up the response," said Tom Frieden, the director of the Centers for Disease Control and Prevention, today at a press conference after returning from a visit to affected countries in West Africa.

“In some ways, the most upsetting thing I saw is what I didn’t see," Frieden said. "I didn’t see enough beds for treatment. So in one facility which had just opened with 35 beds, there were 63 patients, many of them lying on the ground. I didn’t see data coming in from large parts of the country where Ebola might be spreading. I didn’t see the kind of rapid response team that’s needed to stop a single cluster from becoming a large outbreak."

At the U.N. briefing, MSF's Liu sharply criticized the international reaction to the outbreak so far, as MSF has done before. "The response has been too little, too late," she says. Liu also criticized the fact that WHO didn't declare the outbreak a Public Health Emergency of International Concern (PHEIC) until 8 August. "We have lost 6 months," she said.

At a press conference later, Chan acknowledged that WHO and other organizations realized too late just how serious the outbreak would become. "I think it is fair to say that all organizations involved in this underestimated the complexity and the magnitude" of the outbreak, she said. But Chan defended the timing of the PHEIC declaration, which was triggered by the appearance of Ebola in Nigeria. "I think it was the right time to call it," she said.

http://news.sciencemag.org/health/2014/ ... n-epidemic

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Majestic-12 [Bot], Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group