Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Sep 20, 2017 1:37 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 113 posts ]  Go to page 1, 2, 3, 4, 5 ... 12  Next
Author Message
PostPosted: Sun Jul 27, 2014 6:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The Viral Hemorrhagic Fever Consortium has released a large series of partial Ebola sequences from the 2014 outbreak in Western Africa, which are closely related to the Zaire sub-clade, which exists as a recombinant.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 6:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Gueckedou-C07, complete genome
3662 3662 100% 0.0 100% KJ660347.1
Select seq gb|KJ660346.1|
Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Kissidougou-C15, complete genome
3662 3662 100% 0.0 100% KJ660346.1
Select seq gb|KJ660348.1|
Zaire ebolavirus isolate H.sapiens-wt/GIN/2014/Gueckedou-C05, complete genome
3656 3656 100% 0.0 99% KJ660348.1
Select seq gb|KM034562.1|
Zaire ebolavirus strain G3686-1, partial genome
3635 3635 100% 0.0 99% KM034562.1
Select seq gb|KM034561.1|
Zaire ebolavirus strain G3683-1, partial genome
3635 3635 100% 0.0 99% KM034561.1
Select seq gb|KM034560.1|
Zaire ebolavirus strain G3682-1, partial genome
3635 3635 100% 0.0 99% KM034560.1
Select seq gb|KM034559.1|
Zaire ebolavirus strain G3680-1, partial genome
3635 3635 100% 0.0 99% KM034559.1
Select seq gb|KM034558.1|
Zaire ebolavirus strain G3679-1, partial genome
3635 3635 100% 0.0 99% KM034558.1
Select seq gb|KM034557.1|
Zaire ebolavirus strain G3677-2, partial genome
3635 3635 100% 0.0 99% KM034557.1
Select seq gb|KM034556.1|
Zaire ebolavirus strain G3677-1, partial genome
3635 3635 100% 0.0 99% KM034556.1
Select seq gb|KM034555.1|
Zaire ebolavirus strain G3676-2, partial genome
3635 3635 100% 0.0 99% KM034555.1
Select seq gb|KM034554.1|
Zaire ebolavirus strain G3676-1, partial genome
3635 3635 100% 0.0 99% KM034554.1
Select seq gb|KM034553.1|
Zaire ebolavirus strain G3670-1, partial genome
3635 3635 100% 0.0 99% KM034553.1
Select seq gb|KM034552.1|
Zaire ebolavirus strain EM-098, partial genome
3635 3635 100% 0.0 99% KM034552.1
Select seq gb|KM034551.1|
Zaire ebolavirus strain EM-096, partial genome
3635 3635 100% 0.0 99% KM034551.1
Select seq gb|KM034550.1|
Zaire ebolavirus strain EM-095, partial genome
3635 3635 100% 0.0 99% KM034550.1
Select seq gb|KM034549.1|
Zaire ebolavirus strain EM-095B, partial genome
3635 3635 100% 0.0 99% KM034549.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 6:41 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM034562 18957 bp cRNA linear VRL 10-JUL-2014
DEFINITION Zaire ebolavirus strain G3686-1, partial genome.
ACCESSION KM034562
VERSION KM034562.1 GI:661348725
KEYWORDS .
SOURCE Zaire ebolavirus (ZEBOV)
ORGANISM Zaire ebolavirus
Viruses; ssRNA negative-strand viruses; Mononegavirales;
Filoviridae; Ebolavirus.
REFERENCE 1 (bases 1 to 18957)
AUTHORS Goba,A., Khan,H., Momoh,M., Jalloh,S., Fullah,M., Kanneh,L.,
Gevao,S., Happi,C., Gire,S.K., Andersen,K., Malboeuf,C.,
Matranga,C., Sealfon,R., Wohl,S., Gladden,A., Yang,X., Winnicki,S.,
Park,D., Qu,J., Sabeti,P. and Garry,R.
CONSRTM Viral Hemorrhagic Fever Consortium
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2014) Infectious Disease Initiative, Broad
Institute of MIT and Harvard, 75 Ames St., Cambridge, MA 02142, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Novoalign v. 3
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..18957
/organism="Zaire ebolavirus"
/mol_type="viral cRNA"
/strain="G3686-1"
/isolate="Koindu-SL"
/isolation_source="serum"
/host="Homo sapiens"
/db_xref="taxon:186538"
/country="Sierra Leone"
/collection_date="01-Jun-2014"
gene 56..3026
/gene="NP"
mRNA 56..3026
/gene="NP"
/product="nucleoprotein"
misc_signal 56..67
/gene="L"
/note="putative transcription start signal"
CDS 470..2689
/gene="NP"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="nucleoprotein"
/protein_id="AIE11914.1"
/db_xref="GI:661348726"
/translation="MDSRPQKVWMTPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVY
QVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGH
GFRFEVKKRDGVKRLEELLPAVSSGRNIKRTLAAMPEEETTEANAGQFLSFASLFLPK
LVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQG
MHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNE
VNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTN
AMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQ
DTTIPDVVVDPDDGGYGEYQSYSENGMSAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQ
KNSQKGQHTEGRQTQSTPTQNVTGPRRTIHHASAPLTDNDRRNEPSGSTSPRMLTPIN
EEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDE
QQDQDHIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSD
GKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ"
polyA_signal 3015..3026
/gene="NP"
gene 3032..4407
/gene="VP35"
mRNA 3032..4407
/gene="VP35"
/product="polymerase complex protein"
misc_signal 3032..3043
/gene="VP35"
/note="putative transcription start signal"
CDS 3129..4151
/gene="VP35"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="polymerase complex protein"
/protein_id="AIE11915.1"
/db_xref="GI:661348727"
/translation="MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIF
CDIENNPGLCYASQMQQTKPNPKMRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTI
ASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATE
AYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPD
ISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGK
TLGLKI"
gene 4390..5894
/gene="VP40"
mRNA 4390..5894
/gene="VP40"
/product="matrix protein"
misc_signal 4390..4401
/gene="VP40"
/note="putative transcription start signal"
polyA_signal 4397..4407
/gene="VP35"
/note="putative"
CDS 4479..5459
/gene="VP40"
/codon_start=1
/product="matrix protein"
/protein_id="AIE11916.1"
/db_xref="GI:661348728"
/translation="MRRVILPTAPPEYMEAIYPARSNSTIARGGNSNTGFLTPESVNG
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVAD
QKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQE
FVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILL
PNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKV
TSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVVEK"
polyA_signal 5883..5894
/gene="VP40"
gene 5900..8305
/gene="GP"
misc_signal 5900..5911
/gene="GP"
/note="putative transcription start signal"
mRNA join(<6039..6923,6923..>8068)
/gene="GP"
/product="virion spike glycoprotein precursor"
/note="ribosomal slippage"
CDS join(6039..6923,6923..8068)
/gene="GP"
/ribosomal_slippage
/note="additional A residue inserted during transcription;
encodes two disulfide linked subunits GP1 and GP2;
receptor binding and fusion"
/codon_start=1
/product="virion spike glycoprotein precursor"
/protein_id="AIE11917.1"
/db_xref="GI:661348729"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNGPKNISGQSPARTSSDPETNT
TNEDHKIMASENSSAMVQVHSQGRKAAVSHLTTLATISTSPQPPTTKTGPDNSTHNTP
VYKLDISEATQVGQHHRRADNDSTASDTPPATTAAGPLKAENTNTSKSADSLDLATTT
SPQNYSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREVIVNAQ
PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETT
QALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKID
QIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF"
mRNA <6039..>7133
/gene="GP"
/product="sGP"
CDS 6039..7133
/gene="GP"
/note="sGP secreted as an anti-parallel oriented
homodimer; small non-structural secreted glycoprotein"
/codon_start=1
/product="sGP"
/protein_id="AIE11918.1"
/db_xref="GI:661348730"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTDPKTSVVRVRRELLPTQRPTQ
QMKTTKSWLQKIPLQWFKCTVKEGKLQCRI"
mRNA join(<6039..6922,6924..>6933)
/gene="GP"
/product="ssGP"
/note="ribosomal slippage"
CDS join(6039..6922,6924..6933)
/gene="GP"
/ribosomal_slippage
/note="one A residue is deleted or two additional A
residues are inserted at the editing site during
transcription; second non-structural secreted
glycoprotein; secreted in a monomeric form"
/codon_start=1
/product="ssGP"
/protein_id="AIE11919.1"
/db_xref="GI:661348731"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKPH"
misc_feature 7526..7540
/gene="GP"
/note="cleavage site; precursor GP is cleaved by
subtilisin-like cellularprotease furin into subunits GP1
and GP2 that are linked by a disulfide bond"
misc_feature 7790..7870
/gene="GP"
/note="immunosuppressive motif"
gene 8288..9740
/gene="VP30"
mRNA 8288..9740
/gene="VP30"
/product="VP30"
misc_signal 8288..8299
/gene="VP30"
/note="putative transcription start signal"
polyA_signal 8295..8305
/gene="GP"
/note="putative"
CDS 8509..9375
/gene="VP30"
/note="minor nucleoprotein; polymerase complex protein"
/codon_start=1
/product="VP30"
/protein_id="AIE11920.1"
/db_xref="GI:661348732"
/translation="MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRS
ASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLL
LIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIR
TIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDK
GGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTN
PGTCSWSDEGTP"
polyA_signal 9730..9740
/gene="VP30"
/note="putative"
gene 9885..11518
/gene="VP24"
/note="putative"
mRNA 9885..11518
/gene="VP24"
/product="VP24"
misc_signal 9885..9896
/gene="VP24"
/note="putative transcription start signal"
CDS 10345..11100
/gene="VP24"
/note="membrane-associated protein"
/codon_start=1
/product="VP24"
/protein_id="AIE11921.1"
/db_xref="GI:661348733"
/translation="MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAG
IEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGI
QDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKF
INKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRKKPGPAK
FSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI"
polyA_signal 11485..11496
/gene="VP24"
/note="putative"
gene 11501..18282
/gene="L"
mRNA 11501..18282
/gene="L"
/product="polymerase"
misc_signal 11501..11512
/gene="L"
/note="putative transcription start signal"
polyA_signal 11508..11518
/gene="VP24"
/note="putative"
CDS 11581..18219
/gene="L"
/note="involved in synthesis of viral RNAs and
transcriptional RNA editing"
/codon_start=1
/product="polymerase"
/protein_id="AIE11922.1"
/db_xref="GI:661348734"
/translation="MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNC
KLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPILLKALSGNGFCPVEPRCQQFLDE
IIKYTMQDALFLKYYLKNVGAQEDCVDDHFQEKILSSIQGNEFLHQMFFWYDLAILTR
RGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISLLPLNTQGIPHAAMDWYQTSVF
KEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEVEDPVCSDYPNFKIVSML
YQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEI
TEIRALKPSQAHKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKH
ATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPP
LPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPP
HKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKL
PYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATV
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNP
PHNLTLENRNNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVM
GDNQCITVLSVFPLETDAGEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGF
IYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFP
CRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSF
LNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGL
NVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRF
AADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSY
LDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVVWLKP
YEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQ
PAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSH
YSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIRYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENE
LIYDNNPLKGGLNCNISFDNPFFQGKQLNIIEDDLIRLPHLSGWELAKTIMQSIISDS
NNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYY
LTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLR
TSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLHQIVELLVHDSSRHQAF
KTTINDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKDLTRNSSTGSSTNNS
DGHIKRSQEQTTRDPHDGTERSLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGT
ANPKLNFDRSRHNVKSQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQ
DEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIENFKSAVTLAEGEGAGAL
LLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQ
ITDITNPTWFKDQRARLPRQVEVITMDAETTENINRSKLYEAVHKLILHHVDPSVLKA
VVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPH
QNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCDLHLSYIRLGFPSLEKVLYHRYNL
VDSKRGPLVSVTQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYL
KFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSE
VKLIERLTGLLSLFPDGLYRFD"
polyA_signal 18272..18282
/gene="L"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 6:42 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 cggacacaca aaaagaaaga agaattttta ggatcttttg tgtgcgaata actatgagga
61 agattaataa ttttcctctc attgaaattt atatcggaat ttaaattgaa attgttactg
121 taatcatacc tggtttgttt cagagccata tcaccaagat agagaacaac ctaggtctcc
181 ggagggggca agggcatcag tgtgctcagt tgaaaatccc ttgtcaacat ctaggcctta
241 tcacatcaca agttccgcct taaactctgc agggtgatcc aacaacctta atagcaacat
301 tattgttaaa ggacagcatt agttcacagt caaacaagca agattgagaa ttaactttga
361 ttttgaacct gaacacccag aggactggag actcaacaac cctaaagcct ggggtaaaac
421 attagaaata gtttaaagac aaattgctcg gaatcacaaa attccgagta tggattctcg
481 tcctcagaaa gtctggatga cgccgagtct cactgaatct gacatggatt accacaagat
541 cttgacagca ggtctgtccg ttcaacaggg gattgttcgg caaagagtca tcccagtgta
601 tcaagtaaac aatcttgagg aaatttgcca acttatcata caggcctttg aagctggtgt
661 tgattttcaa gagagtgcgg acagtttcct tctcatgctt tgtcttcatc atgcgtacca
721 aggagattac aaacttttct tggaaagtgg cgcagtcaag tatttggaag ggcacgggtt
781 ccgttttgaa gtcaagaagc gtgatggagt gaagcgcctt gaggaattgc tgccagcagt
841 atctagtggg agaaacatta agagaacact tgctgccatg ccggaagagg agacgactga
901 agctaatgcc ggtcagttcc tctcctttgc aagtctattc cttccgaaat tggtagtagg
961 agaaaaggct tgccttgaga aggttcaaag gcaaattcaa gtacatgcag agcaaggact
1021 gatacaatat ccaacagctt ggcaatcagt aggacacatg atggtgattt tccgtttgat
1081 gcgaacaaat tttttgatca aatttcttct aatacaccaa gggatgcaca tggttgccgg
1141 acatgatgcc aacgatgctg tgatttcaaa ttcagtggct caagctcgtt tttcaggtct
1201 attgattgtc aaaacagtac ttgatcatat cctacaaaag acagaacgag gagttcgtct
1261 ccatcctctt gcaaggaccg ccaaggtaaa aaatgaggtg aactccttca aggctgcact
1321 cagctccctg gccaagcatg gagagtatgc tcctttcgcc cgacttttga acctttctgg
1381 agtaaataat cttgagcatg gtcttttccc tcaactgtcg gcaattgcac tcggagtcgc
1441 cacagcccac gggagcaccc tcgcaggagt aaatgttgga gaacagtatc aacagctcag
1501 agaggcagcc actgaggctg agaagcaact ccaacaatat gcggagtctc gtgaacttga
1561 ccatcttgga cttgatgatc aggaaaagaa aattcttatg aacttccatc agaaaaagaa
1621 cgaaatcagc ttccagcaaa caaacgcgat ggtaactcta agaaaagagc gcctggccaa
1681 gctgacagaa gctatcactg ctgcatcact gcccaaaaca agtggacatt acgatgatga
1741 tgacgacatt ccctttccag gacccatcaa tgatgacgac aatcctggcc atcaagatga
1801 tgatccgact gactcacagg atacgaccat tcccgatgtg gtagttgacc ccgatgatgg
1861 aggctacggc gaataccaaa gttactcgga aaacggcatg agtgcaccag atgacttggt
1921 cctattcgat ctagacgagg acgacgagga caccaagcca gtgcctaaca gatcgaccaa
1981 gggtggacaa cagaaaaaca gtcaaaaggg ccagcataca gagggcagac agacacaatc
2041 cacgccaact caaaacgtca caggccctcg cagaacaatc caccatgcca gtgctccact
2101 cacggacaat gacagaagaa acgaaccctc cggctcaacc agccctcgca tgctgacccc
2161 aatcaacgaa gaggcagacc cactggacga tgccgacgac gagacgtcta gccttccgcc
2221 cttagagtca gatgatgaag aacaggacag ggacggaact tctaaccgca cacccactgt
2281 cgccccaccg gctcccgtat acagagatca ctccgaaaag aaagaactcc cgcaagatga
2341 acaacaagat caggaccaca ttcaagaggc caggaaccaa gacagtgaca acacccagcc
2401 agaacattct tttgaggaga tgtatcgcca cattctaaga tcacaggggc catttgatgc
2461 cgttttgtat tatcatatga tgaaggatga gcctgtagtt ttcagtacca gtgatggtaa
2521 agagtacacg tatccggact cccttgaaga ggaatatcca ccatggctca ctgaaaaaga
2581 ggccatgaat gatgagaata gatttgttac actggatggt caacaatttt attggccagt
2641 aatgaatcac aggaataaat tcatggcaat cctgcaacat catcagtgaa tgagcatgta
2701 ataatgggat gatttaatcg acaaatagct aacattaaat agtcaaggaa cgcaaacagg
2761 aagaattttt gatgtctaag gtgtgaatta ttatcacaat aaaagtgatt cttagttttg
2821 aatttaaagc tagcttatta ttactagccg tttttcaaag ttcaatttga gtcttaatgc
2881 aaataagcgt taagccacag ttatagccat aatggtaact caatatctta gccagcgatt
2941 tatctaaatt aaattacatt atgcttttat aacttaccta ctagcctgcc caacatttac
3001 acgatcgttt tataattaag aaaaaactaa tgatgaagat taaaaccttc atcatcctta
3061 cgtcaattga attctctagc actagaagct tattgtcttc aatgtaaaag aaaagctggc
3121 ctaacaagat gacaactaga acaaagggca ggggccatac tgtggccacg actcaaaacg
3181 acagaatgcc aggccctgag ctttcgggct ggatctctga gcagctaatg accggaagga
3241 ttcctgtaaa cgacatcttc tgtgatattg agaacaatcc aggattatgc tacgcatccc
3301 aaatgcaaca aacgaagcca aacccgaaga tgcgcaacag tcaaacccaa acggacccaa
3361 tttgcaatca tagttttgag gaggtagtac aaacattggc ttcattggct actgttgtgc
3421 aacaacaaac catcgcatca gaatcattag aacaacgcat tacgagtctt gagaatggtc
3481 taaagccagt ttatgatatg gcaaaaacaa tctcctcatt gaacagggtt tgtgctgaga
3541 tggttgcaaa atatgatctt ctggtgatga caaccggtcg ggcaacagca accgctgcgg
3601 caactgaggc ttattgggct gaacatggtc aaccaccacc tggaccatca ctttatgaag
3661 aaagtgcgat tcggggtaag attgaatcta gagatgagac tgtccctcaa agtgttaggg
3721 aggcattcaa caatctagac agtaccactt cactaactga ggaaaatttt gggaaacctg
3781 acatttcggc aaaggatttg agaaacatta tgtatgatca cttgcctggt tttggaactg
3841 ctttccacca attagtacaa gtgatttgta aattgggaaa agatagcaat tcattggaca
3901 ttattcatgc tgagttccag gccagcctgg ctgaaggaga ctcccctcaa tgtgccctaa
3961 ttcaaattac aaaaagagtt ccaatcttcc aagatgctgc tccacctgtc atccacatcc
4021 gctctcgagg tgacattccc cgagcttgcc agaagagctt gcgtccagtc ccaccatcac
4081 ccaagattga tcgaggttgg gtatgtgttt ttcagcttca agatggtaaa acacttggac
4141 tcaaaatttg agccaatctc ttttccctcc gaaagaggca actaatagca gaggcttcaa
4201 ctgctgaact atagggtatg ttacattaat gatacacttg tgagtatcag ccctagataa
4261 tataagtcaa ttaaacaacc aagataaaat tgttcatatc ccgctagcag ctttaaagat
4321 aaatgtaata ggagctatac ctctgacagt attataatta attgttatta agtaacccaa
4381 accaaaaatg atgaagatta agaaaaacct acctcgactg agagagtgtt ttttcattaa
4441 ccttcatctt gtaaacgttg agcaaaattg ttaaaaatat gaggcgggtt atattgccta
4501 ctgctcctcc tgaatatatg gaggccatat accctgccag gtcaaattca acaattgcta
4561 ggggtggcaa cagcaataca ggcttcctga caccggagtc agtcaatgga gacactccat
4621 cgaatccact caggccaatt gctgatgaca ccatcgacca tgccagccac acaccaggca
4681 gtgtgtcatc agcattcatc ctcgaagcta tggtgaatgt catatcgggc cccaaagtgc
4741 taatgaagca aattccaatt tggcttcctc taggtgtcgc tgatcaaaag acctacagct
4801 ttgactcaac tacggccgcc atcatgcttg cttcatatac tatcacccat ttcggcaagg
4861 caaccaatcc gcttgtcaga gtcaatcggc tgggtcctgg aatcccggat caccccctca
4921 ggctcctgcg aattggaaac caggctttcc tccaggagtt cgttcttcca ccagtccaac
4981 taccccagta tttcaccttt gatttgacag cactcaaact gatcactcaa ccactgcctg
5041 ctgcaacatg gaccgatgac actccaactg gatcaaatgg agcgttgcgt ccaggaattt
5101 catttcatcc aaaacttcgc cccattcttt tacccaacaa aagtgggaag aaggggaaca
5161 gtgccgatct aacatctccg gagaaaatcc aagcaataat gacttcactc caggacttta
5221 agatcgttcc aattgatcca accaaaaata tcatgggtat cgaagtgcca gaaactctgg
5281 tccacaagct gaccggtaag aaggtgactt ccaaaaatgg acaaccaatc atccctgttc
5341 ttttgccaaa gtacattggg ttggacccgg tggctccagg agacctcacc atggtaatca
5401 cacaggattg tgacacgtgt cattctcctg caagtcttcc agctgtggtt gagaagtaat
5461 tgcaataatt gactcagatc cagttttaca gaatcttctc agggatagtg ataacatctt
5521 tttaataatc cgtctactag aagagatact tctaattgat caatatacta aaggtgcttt
5581 acaccattgt ctcttttctc tcctaaatgt agagcttaac aaaagactca taatatacct
5641 gtttttaaaa gattgattga tgaaagatca tgactaataa cattacaaac aatcctacta
5701 taatcaatac ggtgattcaa atgtcaatct ttctcattgc acatactctt tgtccttatc
5761 ctcaaattgc ctacatgctt acatctgagg acagccagtg tgacttggat tggagatgtg
5821 gaggaaaaat cggggcccat ttctaagttg ttcacaatct aagtacagac attgctcttc
5881 taattaagaa aaaatcggcg atgaagatta agccgacagt gagcgtaatc ttcatctctc
5941 ttagattatt tgtcttccag agtaggggtc atcaggtcct tttcaattgg ataaccaaaa
6001 taagcttcac tagaaggata ttgtgaggcg acaacacaat gggtgttaca ggaatattgc
6061 agttacctcg tgatcgattc aagaggacat cattctttct ttgggtaatt atccttttcc
6121 aaagaacatt ttccatcccg cttggagtta tccacaatag tacattacag gttagtgatg
6181 tcgacaaact agtttgtcgt gacaaactgt catccacaaa tcaattgaga tcagttggac
6241 tgaatctcga ggggaatgga gtggcaactg acgtgccatc tgtgactaaa agatggggct
6301 tcaggtccgg tgtcccacca aaggtggtca attatgaagc tggtgaatgg gctgaaaact
6361 gctacaatct tgaaatcaaa aaacctgacg ggagtgagtg tctaccagca gcgccagacg
6421 ggattcgggg cttcccccgg tgccggtatg tgcacaaagt atcaggaacg ggaccatgtg
6481 ccggagactt tgccttccac aaagagggtg ctttcttcct gtatgatcga cttgcttcca
6541 cagttatcta ccgaggaacg actttcgctg aaggtgtcgt tgcatttctg atactgcccc
6601 aagctaagaa ggacttcttc agctcacacc ccttgagaga gccggtcaat gcaacggagg
6661 acccgtcgag tggctattat tctaccacaa ttagatatca ggctaccggt tttggaacta
6721 atgagacaga gtacttgttc gaggttgaca atttgaccta cgtccaactt gaatcaagat
6781 tcacaccaca gtttctgctc cagctgaatg agacaatata tgcaagtggg aagaggagca
6841 acaccacggg aaaactaatt tggaaggtca accccgaaat tgatacaaca atcggggagt
6901 gggccttctg ggaaactaaa aaaacctcac tagaaaaatt cgcagtgaag agttgtcttt
6961 cacagctgta tcaaacggac ccaaaaacat cagtggtcag agtccggcgc gaacttcttc
7021 cgacccagag accaacacaa caaatgaaga ccacaaaatc atggcttcag aaaattcctc
7081 tgcaatggtt caagtgcaca gtcaaggaag gaaagctgca gtgtcgcatc tgacaaccct
7141 tgccacaatc tccacgagtc ctcaacctcc cacaaccaaa acaggtccgg acaacagcac
7201 ccataataca cccgtgtata aacttgacat ctctgaggca actcaagttg gacaacatca
7261 ccgtagagca gacaacgaca gcacagcctc cgacactccc cccgccacga ccgcagccgg
7321 acccttaaaa gcagagaaca ccaacacgag taagagcgct gactccctgg acctcgccac
7381 cacgacaagc ccccaaaact acagcgagac tgctggcaac aacaacactc atcaccaaga
7441 taccggagaa gagagtgcca gcagcgggaa gctaggctta attaccaata ctattgctgg
7501 agtagcagga ctgatcacag gcgggagaag gactcgaaga gaagtaattg tcaatgctca
7561 acccaaatgc aaccccaatt tacattactg gactactcag gatgaaggtg ctgcaatcgg
7621 attggcctgg ataccatatt tcgggccagc agccgaagga atttacacag aggggctaat
7681 gcacaaccaa gatggtttaa tctgtgggtt gaggcagctg gccaacgaaa cgactcaagc
7741 tctccaactg ttcctgagag ccacaactga gctgcgaacc ttttcaatcc tcaaccgtaa
7801 ggcaattgac ttcctgctgc agcgatgggg tggcacatgc cacattttgg gaccggactg
7861 ctgtatcgaa ccacatgatt ggaccaagaa cataacagac aaaattgatc agattattca
7921 tgattttgtt gataaaaccc ttccggacca gggggacaat gacaattggt ggacaggatg
7981 gagacaatgg ataccggcag gtattggagt tacaggtgtt ataattgcag ttatcgcttt
8041 attctgtata tgcaaatttg tcttttagtc tttcttcaga ttgtttcacg gcaaaactca
8101 acctcaaatc aatgaaacta ggatttaatt atatgaatca cttgaatcta agattacttg
8161 acaaatgata acataataca ctggagcttc aaacatagcc aatgtgattc taactccttt
8221 aaactcacag ttaatcataa acaaggtttg acatcaatct agctatatct ttaagaatga
8281 taaacttgat gaagattaag aaaaaggtaa tctttcgatt atctttagtc ttcatccttg
8341 attctacaat catgacagtt gtctttaatg aaaaaggaaa aaagcctttt tattaagttg
8401 taataatcag atctgcaaac cggtagaatt tagttgtaac ctaacacaca caaagcattg
8461 gtaaaaaagt caatagaaat ttaaacagtg agtgcagaca actcttaaat ggaagcttca
8521 tatgagagag gacgcccccg agctgccaga cagcattcaa gggatggaca cgaccaccat
8581 gttcgagcac gatcatcatc cagagagaat tatcgaggtg agtaccgtca atcaaggagc
8641 gcctcacaag tgcgcgttcc tactgtattt cataagaaga gagttgaacc attaacagtt
8701 cctccagcac ctaaagacat atgtccgacc ttgaaaaaag gatttttgtg tgacagtagt
8761 ttttgcaaaa aagaccacca gttagaaagt ttaactgata gggaattact cctactaatc
8821 gcccgtaaga cttgtggatc agtagaacaa caattaaata taactgcacc caaggactcg
8881 cgcttagcaa atccaacggc tgatgatttc cagcaagagg aaggtccaaa aattaccttg
8941 ttgacactga tcaagacggc agaacactgg gcgagacaag acatccgaac catagaggat
9001 tccaaattaa gggcattgtt aactctatgt gctgtgatga cgaggaaatt ctcaaaatcc
9061 cagctgagtc ttttgtgtga gacacaccta aggcgcgaag ggcttgggca agatcaggca
9121 gaacccgttc tcgaagtata tcaacgatta cacagtgata aaggaggcag ttttgaagct
9181 gcactatggc aacaatggga ccgacaatcc ctaattatgt ttatcactgc attcttgaat
9241 atcgctctcc agttaccgtg tgaaagttct gctgtcgttg tttcagggtt aagaacattg
9301 gttcctcaat cagataatga ggaagcttca accaacccgg ggacatgctc atggtctgat
9361 gagggtaccc cttaataagg ctgactaaaa cactatataa ccttctactt gatcacaata
9421 ctccgtatac ctatcatcat atatttaatc aagacgatat cctttaaaac ttattcagta
9481 ctataatcac tctcatttca aattgataag atatgcataa ttgccttaat atataaagag
9541 gtatgatata acccaaacat tgaccaaaga aaatcataat ctcgtatcgc tcgcaatata
9601 acctgccaag catacctctt gcacaaagtg attcttgtac acaaataatg tttgactcta
9661 caggaggtag caacgatcca tctcatcaaa aaataagtat tttatgattt actaatgatc
9721 tcttaaaata ttaagaaaaa ctgacggaac ataaattctt tctgcttcaa gttgtggagg
9781 aggtctatgg tattcgctat tgttatatta caatcaataa caagcttgta aaaatattgt
9841 tcttgtttca ggaggtatat tgtgaccgga aaagctaaac taatgatgaa gattaatgcg
9901 gaggtctgat gagaataaac cttattattc agattaggcc ccaagaggca ttcttcatct
9961 ccttttagca aaatactatt tcaggatagt ccagctagtg acacgtcttt tagctgtata
10021 ccagttgccc ctgagatacg ccacaaaagt gtctctgagc taaagtggtc tgtacacatc
10081 tcatacattg tattaggggc aataatatct aattgaactt agccatttaa aatttagtgc
10141 ataaatctgg gctaactcca ccaggtcaac tccattggct gaaaagaagc ccacctacaa
10201 cgaacattac tttgagcgcc ctcacaatta aaaaataaga gcgtcgttcc aacaatcgag
10261 cgcaaggtta caaggttgaa ctgagagtgt ctagacaaca aaatatcgat actccagaca
10321 ccaagcaaga cctgagaaaa aaccatggcc aaagctacgg gacgatacaa tctaatatcg
10381 cccaaaaagg acctggagaa aggggttgtc ttaagcgacc tctgtaactt cttagttagt
10441 caaactattc aagggtggaa agtttattgg gctggtattg agtttgatgt gactcacaaa
10501 ggaatggccc tattgcatag actgaaaact aatgactttg cccctgcatg gtcaatgaca
10561 aggaacctat ttccccattt atttcaaaat ccgaattcca ctattgaatc accgctgtgg
10621 gcactgagag tcatccttgc agcagggata caggaccagt taattgacca gtctttgatt
10681 gaacccttag caggagccct tggtctgatc tctgattggc tgctaacaac caacactaac
10741 catttcaaca tgcgaacaca acgtgtcaag gaacaattga gcctaaaaat gctgtcgttg
10801 attcgatcca atattctcaa gtttattaac aaattggatg ctctacatgt cgtgaactac
10861 aatggattat tgagcagtat tgaaattgga actcaaaatc atacaatcat cataactcga
10921 actaacatgg gttttctggt ggagctccaa gaacccgaca aatcggcaat gaaccgcaag
10981 aagcctgggc cggcgaaatt ttccctcctt catgagtcca cactgaaagc atttacacaa
11041 gggtcctcga cacgaatgca aagtttaatt cttgaattca atagctctct tgctatctaa
11101 ctaagatgga atacttcata ttgggctaac tcatatatgc tgactcaata gttaacttga
11161 catctctgcc ttcataatca gatatataag cataataaat aaatactcat atttcttgat
11221 aatttgttta accacagata aatcctcact gtaagccagc ttccaagttg acacccttac
11281 aaaaaccagg actcagaatc cctcaaataa gagattccaa gacaacatca tagaattgct
11341 ttattatatt aataagcatt ttatcactag aaatccaata tacgaaatgg ttaattgtaa
11401 ctaaacccgc aggtcatgtg tgttaggttt cacaaattat atatattact aactccatac
11461 tcgtaactaa cattagataa gtaggttaag aaaaaagctt gaggaagatt aagaaaaact
11521 gcttattggg tctttccgtg ttttagatga agcagttgac attcttcctc ttgatattaa
11581 atggctacac aacataccca atacccagac gccaggttat catcaccaat tgtattggac
11641 caatgtgacc ttgtcactag agcttgcggg ttgtattcat catactccct taatccgcaa
11701 ctacgcaact gtaaactccc gaaacatata taccgtttaa aatatgatgt aactgttacc
11761 aagttcttaa gtgatgtacc agtggcgaca ttgcccatag atttcatagt tccaattctt
11821 ctcaaggcac tatcaggcaa tgggttctgt cctgttgagc cgcggtgcca acagttctta
11881 gatgaaatta ttaagtacac aatgcaagat gctctcttcc tgaaatatta tctcaaaaat
11941 gtgggtgctc aagaagactg tgttgatgac cactttcaag aaaaaatctt atcttcaatt
12001 cagggcaatg aatttttaca tcaaatgttt ttctggtatg acctggctat tttaactcga
12061 aggggtagat taaatcgagg aaactctaga tcaacgtggt ttgttcatga tgatttaata
12121 gacatcttag gctatgggga ctatgttttt tggaagatcc caatttcact gttaccactg
12181 aacacacaag gaatccccca tgctgctatg gattggtatc agacatcagt attcaaagaa
12241 gcggttcaag ggcatacaca cattgtttct gtttctactg ccgatgtctt gataatgtgc
12301 aaagatttaa ttacatgtcg attcaacaca actctaatct caaaaatagc agaggttgag
12361 gacccagttt gctctgatta tcccaatttt aagattgtgt ctatgcttta ccagagcgga
12421 gattacttac tctccatatt agggtctgat gggtataaaa tcattaagtt tctcgaacca
12481 ttgtgcttgg ctaaaattca attgtgctca aagtacaccg agaggaaggg ccgattctta
12541 acacaaatgc atttagctgt aaatcacacc ctggaagaaa ttacagaaat acgtgcacta
12601 aagccttcac aggctcacaa gatccgtgaa ttccatagaa cattgataag gctggagatg
12661 acgccacaac aactttgtga gctattttcc atacaaaaac actgggggca tcctgtgcta
12721 catagtgaaa cagcaatcca aaaagttaaa aaacatgcta cggtgctaaa agcattacgc
12781 cctatcgtga ttttcgagac atattgtgtt tttaaatata gcattgcaaa acattatttt
12841 gatagtcaag gatcttggta cagtgttacc tcagatagaa atctaacacc aggtcttaat
12901 tcttatatca aaagaaatca attccctccg ttgccaatga ttaaagaact gctatgggaa
12961 ttttaccacc ttgaccatcc tccacttttc tcaaccaaaa ttattagtga cttaagtatt
13021 tttataaaag acagagctac tgcagtagaa aggacatgct gggatgcagt attcgagcct
13081 aatgttctgg gatataatcc acctcacaaa ttcagtacca aacgtgtacc ggaacaattt
13141 ttagagcaag aaaacttttc tattgagaat gttctttcct acgcgcaaaa actcgagtat
13201 ctactaccac aatatcggaa tttttctttc tcattgaaag agaaagagtt gaatgtaggt
13261 agaactttcg gaaaattgcc ttatccgact cgcaatgttc aaacactttg tgaagctctg
13321 ttagctgatg gtcttgctaa agcatttcct agcaatatga tggtagttac ggaacgtgaa
13381 caaaaagaaa gcttattgca tcaagcatca tggcaccaca caagtgatga tttcggtgag
13441 catgccacag ttagagggag tagctttgta actgatttag agaaatacaa tcttgcattt
13501 aggtatgagt ttacagcacc ttttatagaa tattgcaacc gttgctatgg tgttaagaat
13561 gtttttaatt ggatgcatta tacaatccca cagtgttata tgcatgtcag tgattattat
13621 aatccaccgc ataacctcac actggaaaat cgaaacaacc cccctgaagg gcctagttca
13681 tacaggggtc atatgggagg gattgaagga ctgcaacaaa aactctggac aagtatttca
13741 tgtgctcaaa tttctttagt tgaaattaag actggtttta agttgcgctc agctgtgatg
13801 ggtgacaatc agtgcattac cgttttatca gtcttcccct tagagactga tgcaggcgag
13861 caggaacaga gcgccgagga caatgcagcg agggtggccg ccagcctagc aaaagttaca
13921 agtgcctgtg gaatcttttt aaaacctgat gaaacatttg tacattcagg ttttatctat
13981 tttggaaaaa aacaatattt gaatggggtc caattgcctc agtcccttaa aacggctaca
14041 agaatggcac cattgtctga tgcaattttt gatgatcttc aagggaccct ggctagtata
14101 ggtactgctt ttgagcgatc catctctgag acacgacata tctttccttg cagaataacc
14161 gcagctttcc atacgttctt ttcggtgaga atcttgcaat atcatcacct cggatttaat
14221 aaaggttttg accttggaca gttaacactc ggcaaacctc tggatttcgg aacaatatca
14281 ttggcactag cggtaccgca ggtgcttgga gggttatcct tcttgaatcc tgagaaatgt
14341 ttctaccgga atctaggaga tccagttacc tcaggtttat tccagttaaa aacttatctc
14401 cgaatgattg agatggatga tttattctta cctttaattg cgaagaaccc tgggaactgc
14461 actgccattg actttgtgct aaatcctagc ggattaaatg ttcctgggtc gcaagactta
14521 acttcatttc tgcgccagat tgtacgtagg actatcaccc taagtgcgaa aaacaaactt
14581 attaatacct tatttcatgc atcagctgac ttcgaagacg aaatggtttg taagtggctc
14641 ttatcatcaa ctcctgttat gagtcgtttc gcagccgata tattttcacg cacgccgagc
14701 gggaagcgat tgcaaattct aggatacttg gaaggaacac gcacattatt agcctctaag
14761 atcatcaaca ataatacaga gacgccggtt ttggacagac tgaggaagat aacattgcaa
14821 aggtggagtc tatggtttag ttatcttgat cattgtgata atatcctggc ggaggcttta
14881 acccaaataa cttgcacagt tgatttagca cagatcctga gggaatattc atgggcacat
14941 attttagagg ggagacctct tattggagcc acactcccat gtatgattga gcaattcaaa
15001 gtggtttggc tgaaacccta cgaacaatgt ccgcagtgtt caaatgccaa gcaacctggt
15061 gggaaaccat tcgtgtcagt agcagtcaag aaacatattg ttagtgcatg gccaaatgca
15121 tcccgaataa gctggactat cggggatgga atcccataca ttggatcaag gacagaagat
15181 aagatagggc aacctgctat taaaccaaaa tgtccttccg cagccttaag agaggccatt
15241 gaattggcgt cccgtttaac atgggtaact caaggcagtt cgaacagtga cttgctaata
15301 aaaccatttt tggaagcacg agtaaattta agtgttcaag aaatacttca aatgacccct
15361 tcacattact cgggaaatat tgttcatagg tacaacgatc aatacagtcc tcattctttc
15421 atggccaatc gtatgagtaa ctcagcaacg cgattgattg tttctacaaa cactttaggt
15481 gagttttcag gaggtggcca atcggcacgc gacagcaata ttattttcca gaatgttata
15541 aattatgcag ttgcactgtt cgatattaaa tttagaaaca ctgaggctac agatatccgg
15601 tataatcgtg ctcaccttca tctaactaag tgttgcaccc gggaggtacc agctcagtac
15661 ttaacataca catctacatt ggatttagat ttaacaagat accgagaaaa tgaattgatt
15721 tatgacaata atcctctaaa aggaggactc aattgcaata tctcatttga taacccattt
15781 ttccaaggca aacagctgaa cattatagaa gatgacctta ttcgactgcc tcacttatct
15841 ggatgggagc tagctaagac catcatgcaa tcaattattt cagatagcaa taattcgtct
15901 acagacccaa ttagcagtgg agaaacaaga tcattcacta cccatttctt aacttatccc
15961 aagataggac ttctgtacag ttttggggcc tttgtaagtt attatcttgg caatacaatt
16021 cttcggacta agaaattaac acttgacaat tttttatatt acttaactac ccaaattcat
16081 aatctaccac atcgctcatt gcgaatactt aagccaacat tcaaacatgc aagcgttatg
16141 tcacgattaa tgagtattga tccccatttt tctatttaca taggcggtgc tgcaggtgac
16201 agaggactct cagatgcggc caggttattt ttgagaacgt ccatttcatc ttttcttaca
16261 tttgtaaagg aatggataat taatcgcgga acaattgtcc ctttatggat agtatatcca
16321 ttagagggtc aaaatccaac acctgttaat aatttcctcc atcagatcgt agaactgctg
16381 gtgcatgatt catcaagaca ccaggctttt aaaactacca taaatgatca tgtacatcct
16441 cacgacaatc ttgtttacac atgtaagagt acagccagca atttcttcca tgcgtcattg
16501 gcgtactgga ggagcaggca cagaaacagc aaccgaaaag acttgacaag aaactcttca
16561 actggatcaa gcacaaacaa cagtgatggt catattaaga gaagtcaaga acaaaccacc
16621 agagatccac atgatggcac tgaacggagt ctagtcctgc aaatgagcca tgaaataaaa
16681 agaacgacaa ttccacaaga gaacacgcac cagggtccgt cgttccagtc atttctaagt
16741 gactctgctt gcggtacagc aaacccaaaa ctaaatttcg atagatcgag acacaatgtg
16801 aaatctcagg atcataactc agcatccaag agggaaggtc atcaaataat ctcacatcgt
16861 ctagtcctac ctttctttac attatctcaa gggacacgcc aattaacgtc atccaatgag
16921 tcacaaaccc aagatgagat atcaaagtac ttacggcaat tgagatccgt cattgatacc
16981 acagtttatt gtaggtttac cggtatagtc tcgtccatgc attacaaact tgatgaggtc
17041 ctttgggaaa tagagaattt taagtcggct gtgacgctgg cagagggaga aggtgctggt
17101 gccttactat tgattcagaa ataccaagtt aagaccttat ttttcaacac gctagctact
17161 gagtccagta tagagtcaga aatagtatca ggaatgacta ctcctaggat gcttctacct
17221 gttatgtcaa aattccataa tgaccaaatt gagattattc ttaacaactc agcaagccaa
17281 ataacagaca taacaaatcc tacttggttt aaagaccaaa gagcaaggct acctaggcaa
17341 gtcgaggtta taaccatgga tgcagagacg acagagaata taaacagatc gaaattgtac
17401 gaagctgtac ataaattgat cttacaccat gttgatccca gcgtattgaa agcagtggtc
17461 cttaaagtct ttctaagtga taccgagggt atgttatggc taaatgataa tctagccccg
17521 ttttttgcca ctgggtattt aattaagcca ataacgtcaa gtgccaggtc tagtgagtgg
17581 tatctttgtc tgacgaactt cttatcaact acacgtaaga tgccacacca aaaccatctc
17641 agttgtaagc aggtaatact tacggcattg caactgcaaa ttcaacggag cccatactgg
17701 ctaagtcatt taactcagta tgctgactgc gatttacatt taagctatat ccgccttggt
17761 tttccatcat tagagaaagt actataccac aggtataacc ttgtcgattc aaaaagaggt
17821 ccactagtct ctgtcactca gcacttagca catcttaggg cagagattcg agaattgacc
17881 aatgattata atcaacagcg acaaagtcgg actcaaacat atcactttat tcgtactgca
17941 aaaggacgaa tcacaaaact agtcaatgat tatttaaaat tctttcttat tgtacaagca
18001 ttaaaacata atgggacatg gcaagctgag tttaagaaat taccagagtt gattagtgtg
18061 tgcaataggt tctatcatat tagagattgt aattgtgaag aacgtttctt agttcaaacc
18121 ttatatttac atagaatgca ggattctgaa gttaagctta tcgaaaggct gacagggctt
18181 ctgagtttat ttccagatgg tctctacagg ttcgattgaa taaccgtgca tagtattttg
18241 atacttgtaa aggttggtta tcaacataca gattataaaa aactcataaa ttgctctcat
18301 acatcatctt gatctgattt caataaataa ctatttagat aacgaaagga gtccttacat
18361 tatacactat atttggcctc tctccctgcg tgataatcaa aaaattcaca atacagcatg
18421 tgtgacatat tactgctgca atgagtctaa cgcaacataa taaactccgc actctttata
18481 attaagcttt aacgataggt ctgggctcat attgttattg atatagtaat gttgtatcaa
18541 tatcttgcca gatggaatag tgctttggtt gataacacga cttcttaaaa caaaactgat
18601 ctttaagatt aagtttttta taattgtcat tgctttaatt tgtcgattta aaaatggtga
18661 tagccttaat ctttgtgtaa aataagagat taggtgtaat aactttaaca tttttgtcta
18721 gtaagctact attccattca gaatgataaa attaaaagaa aagacatgac tgtaaaatca
18781 gaaatacctt ctttacaata tagcagacta gataataatc ttcgtgttaa tgataattaa
18841 ggcattgacc acgctcatca gaaggctcac tagaataaac gttgcaaaaa ggatccctgg
18901 aaaaatggtc gcacacaaaa atttaaaaat aaatctattt cttctttttt gtgtgtc

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM034561 18908 bp cRNA linear VRL 10-JUL-2014
DEFINITION Zaire ebolavirus strain G3683-1, partial genome.
ACCESSION KM034561
VERSION KM034561.1 GI:661348715
KEYWORDS .
SOURCE Zaire ebolavirus (ZEBOV)
ORGANISM Zaire ebolavirus
Viruses; ssRNA negative-strand viruses; Mononegavirales;
Filoviridae; Ebolavirus.
REFERENCE 1 (bases 1 to 18908)
AUTHORS Goba,A., Khan,H., Momoh,M., Jalloh,S., Fullah,M., Kanneh,L.,
Gevao,S., Happi,C., Gire,S.K., Andersen,K., Malboeuf,C.,
Matranga,C., Sealfon,R., Wohl,S., Gladden,A., Yang,X., Winnicki,S.,
Park,D., Qu,J., Sabeti,P. and Garry,R.
CONSRTM Viral Hemorrhagic Fever Consortium
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2014) Infectious Disease Initiative, Broad
Institute of MIT and Harvard, 75 Ames St., Cambridge, MA 02142, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Novoalign v. 3
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..18908
/organism="Zaire ebolavirus"
/mol_type="viral cRNA"
/strain="G3683-1"
/isolate="Koindu-SL"
/isolation_source="serum"
/host="Homo sapiens"
/db_xref="taxon:186538"
/country="Sierra Leone"
/collection_date="01-Jun-2014"
gene 23..2993
/gene="NP"
mRNA 23..2993
/gene="NP"
/product="nucleoprotein"
misc_signal 23..34
/gene="L"
/note="putative transcription start signal"
CDS 437..2656
/gene="NP"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="nucleoprotein"
/protein_id="AIE11905.1"
/db_xref="GI:661348716"
/translation="MDSRPQKVWMTPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVY
QVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGH
GFRFEVKKRDGVKRLEELLPAVSSGRNIKRTLAAMPEEETTEANAGQFLSFASLFLPK
LVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQG
MHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNE
VNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTN
AMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQ
DTTIPDVVVDPDDGGYGEYQSYSENGMSAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQ
KNSQKGQHTEGRQTQSTPTQNVTGPRRTIHHASAPLTDNDRRNEPSGSTSPRMLTPIN
EEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDE
QQDQDHIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSD
GKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ"
polyA_signal 2982..2993
/gene="NP"
gene 2999..4374
/gene="VP35"
mRNA 2999..4374
/gene="VP35"
/product="polymerase complex protein"
misc_signal 2999..3010
/gene="VP35"
/note="putative transcription start signal"
CDS 3096..4118
/gene="VP35"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="polymerase complex protein"
/protein_id="AIE11906.1"
/db_xref="GI:661348717"
/translation="MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIF
CDIENNPGLCYASQMQQTKPNPKMRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTI
ASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATE
AYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPD
ISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGK
TLGLKI"
gene 4357..5861
/gene="VP40"
mRNA 4357..5861
/gene="VP40"
/product="matrix protein"
misc_signal 4357..4368
/gene="VP40"
/note="putative transcription start signal"
polyA_signal 4364..4374
/gene="VP35"
/note="putative"
CDS 4446..5426
/gene="VP40"
/codon_start=1
/product="matrix protein"
/protein_id="AIE11907.1"
/db_xref="GI:661348718"
/translation="MRRVILPTAPPEYMEAIYPARSNSTIARGGNSNTGFLTPESVNG
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVAD
QKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQE
FVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILL
PNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKV
TSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVVEK"
polyA_signal 5850..5861
/gene="VP40"
gene 5867..8272
/gene="GP"
misc_signal 5867..5878
/gene="GP"
/note="putative transcription start signal"
mRNA join(<6006..6890,6890..>8035)
/gene="GP"
/product="virion spike glycoprotein precursor"
/note="ribosomal slippage"
CDS join(6006..6890,6890..8035)
/gene="GP"
/ribosomal_slippage
/note="additional A residue inserted during transcription;
encodes two disulfide linked subunits GP1 and GP2;
receptor binding and fusion"
/codon_start=1
/product="virion spike glycoprotein precursor"
/protein_id="AIE11908.1"
/db_xref="GI:661348719"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNGPKNISGQSPARTSSDPETNT
TNEDHKIMASENSSAMVQVHSQGRKAAVSHLTTLATISTSPQPPTTKTGPDNSTHNTP
VYKLDISEATQVGQHHRRADNDSTASDTPPATTAAGPLKAENTNTSKSADSLDLATTT
SPQNYSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREVIVNAQ
PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETT
QALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKID
QIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF"
mRNA <6006..>7100
/gene="GP"
/product="sGP"
CDS 6006..7100
/gene="GP"
/note="sGP secreted as an anti-parallel oriented
homodimer; small non-structural secreted glycoprotein"
/codon_start=1
/product="sGP"
/protein_id="AIE11909.1"
/db_xref="GI:661348720"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTDPKTSVVRVRRELLPTQRPTQ
QMKTTKSWLQKIPLQWFKCTVKEGKLQCRI"
mRNA join(<6006..6889,6891..>6900)
/gene="GP"
/product="ssGP"
/note="ribosomal slippage"
CDS join(6006..6889,6891..6900)
/gene="GP"
/ribosomal_slippage
/note="one A residue is deleted or two additional A
residues are inserted at the editing site during
transcription; second non-structural secreted
glycoprotein; secreted in a monomeric form"
/codon_start=1
/product="ssGP"
/protein_id="AIE11910.1"
/db_xref="GI:661348721"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKPH"
misc_feature 7493..7507
/gene="GP"
/note="cleavage site; precursor GP is cleaved by
subtilisin-like cellularprotease furin into subunits GP1
and GP2 that are linked by a disulfide bond"
misc_feature 7757..7837
/gene="GP"
/note="immunosuppressive motif"
gene 8255..9707
/gene="VP30"
mRNA 8255..9707
/gene="VP30"
/product="VP30"
misc_signal 8255..8266
/gene="VP30"
/note="putative transcription start signal"
polyA_signal 8262..8272
/gene="GP"
/note="putative"
CDS 8476..9342
/gene="VP30"
/note="minor nucleoprotein; polymerase complex protein"
/codon_start=1
/product="VP30"
/protein_id="AIE11911.1"
/db_xref="GI:661348722"
/translation="MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRS
ASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLL
LIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIR
TIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDK
GGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTN
PGTCSWSDEGTP"
polyA_signal 9697..9707
/gene="VP30"
/note="putative"
gene 9852..11485
/gene="VP24"
/note="putative"
mRNA 9852..11485
/gene="VP24"
/product="VP24"
misc_signal 9852..9863
/gene="VP24"
/note="putative transcription start signal"
CDS 10312..11067
/gene="VP24"
/note="membrane-associated protein"
/codon_start=1
/product="VP24"
/protein_id="AIE11912.1"
/db_xref="GI:661348723"
/translation="MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAG
IEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGI
QDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKF
INKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRKKPGPAK
FSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI"
polyA_signal 11452..11463
/gene="VP24"
/note="putative"
gene 11468..18249
/gene="L"
mRNA 11468..18249
/gene="L"
/product="polymerase"
misc_signal 11468..11479
/gene="L"
/note="putative transcription start signal"
polyA_signal 11475..11485
/gene="VP24"
/note="putative"
CDS 11548..18186
/gene="L"
/note="involved in synthesis of viral RNAs and
transcriptional RNA editing"
/codon_start=1
/product="polymerase"
/protein_id="AIE11913.1"
/db_xref="GI:661348724"
/translation="MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNC
KLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPILLKALSGNGFCPVEPRCQQFLDE
IIKYTMQDALFLKYYLKNVGAQEDCVDDHFQEKILSSIQGNEFLHQMFFWYDLAILTR
RGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISLLPLNTQGIPHAAMDWYQTSVF
KEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEVEDPVCSDYPNFKIVSML
YQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEI
TEIRALKPSQAHKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKH
ATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPP
LPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPP
HKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKL
PYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATV
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNP
PHNLTLENRNNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVM
GDNQCITVLSVFPLETDAGEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGF
IYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFP
CRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSF
LNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGL
NVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRF
AADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSY
LDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVVWLKP
YEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQ
PAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSH
YSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENE
LIYDNNPLKGGLNCNISFDNPFFQGKQLNIIEDDLIRLPHLSGWELAKTIMQSIISDS
NNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYY
LTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLR
TSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLHQIVELLVHDSSRHQAF
KTTINDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKDLTRNSSTGSSTNNS
DGHIKRSQEQTTRDPHDGTERSLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGT
ANPKLNFDRSRHNVKSQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQ
DEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIENFKSAVTLAEGEGAGAL
LLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQ
ITDITNPTWFKDQRARLPRQVEVITMDAETTENINRSKLYEAVHKLILHHVDPSVLKA
VVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPH
QNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCDLHLSYIRLGFPSLEKVLYHRYNL
VDSKRGPLVSVTQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYL
KFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSE
VKLIERLTGLLSLFPDGLYRFD"
polyA_signal 18239..18249
/gene="L"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 tcttttgtgt gcgaataact atgaggaaga ttaataattt tcctctcatt gaaatttata
61 tcggaattta aattgaaatt gttactgtaa tcatacctgg tttgtttcag agccatatca
121 ccaagataga gaacaaccta ggtctccgga gggggcaagg gcatcagtgt gctcagttga
181 aaatcccttg tcaacatcta ggccttatca catcacaagt tccgccttaa actctgcagg
241 gtgatccaac aaccttaata gcaacattat tgttaaagga cagcattagt tcacagtcaa
301 acaagcaaga ttgagaatta actttgattt tgaacctgaa cacccagagg actggagact
361 caacaaccct aaagcctggg gtaaaacatt agaaatagtt taaagacaaa ttgctcggaa
421 tcacaaaatt ccgagtatgg attctcgtcc tcagaaagtc tggatgacgc cgagtctcac
481 tgaatctgac atggattacc acaagatctt gacagcaggt ctgtccgttc aacaggggat
541 tgttcggcaa agagtcatcc cagtgtatca agtaaacaat cttgaggaaa tttgccaact
601 tatcatacag gcctttgaag ctggtgttga ttttcaagag agtgcggaca gtttccttct
661 catgctttgt cttcatcatg cgtaccaagg agattacaaa cttttcttgg aaagtggcgc
721 agtcaagtat ttggaagggc acgggttccg ttttgaagtc aagaagcgtg atggagtgaa
781 gcgccttgag gaattgctgc cagcagtatc tagtgggaga aacattaaga gaacacttgc
841 tgccatgccg gaagaggaga cgactgaagc taatgccggt cagttcctct cctttgcaag
901 tctattcctt ccgaaattgg tagtaggaga aaaggcttgc cttgagaagg ttcaaaggca
961 aattcaagta catgcagagc aaggactgat acaatatcca acagcttggc aatcagtagg
1021 acacatgatg gtgattttcc gtttgatgcg aacaaatttt ttgatcaaat ttcttctaat
1081 acaccaaggg atgcacatgg ttgccggaca tgatgccaac gatgctgtga tttcaaattc
1141 agtggctcaa gctcgttttt caggtctatt gattgtcaaa acagtacttg atcatatcct
1201 acaaaagaca gaacgaggag ttcgtctcca tcctcttgca aggaccgcca aggtaaaaaa
1261 tgaggtgaac tccttcaagg ctgcactcag ctccctggcc aagcatggag agtatgctcc
1321 tttcgcccga cttttgaacc tttctggagt aaataatctt gagcatggtc ttttccctca
1381 actgtcggca attgcactcg gagtcgccac agcccacggg agcaccctcg caggagtaaa
1441 tgttggagaa cagtatcaac agctcagaga ggcagccact gaggctgaga agcaactcca
1501 acaatatgcg gagtctcgtg aacttgacca tcttggactt gatgatcagg aaaagaaaat
1561 tcttatgaac ttccatcaga aaaagaacga aatcagcttc cagcaaacaa acgcgatggt
1621 aactctaaga aaagagcgcc tggccaagct gacagaagct atcactgctg catcactgcc
1681 caaaacaagt ggacattacg atgatgatga cgacattccc tttccaggac ccatcaatga
1741 tgacgacaat cctggccatc aagatgatga tccgactgac tcacaggata cgaccattcc
1801 cgatgtggta gttgaccccg atgatggagg ctacggcgaa taccaaagtt actcggaaaa
1861 cggcatgagt gcaccagatg acttggtcct attcgatcta gacgaggacg acgaggacac
1921 caagccagtg cctaacagat cgaccaaggg tggacaacag aaaaacagtc aaaagggcca
1981 gcatacagag ggcagacaga cacaatccac gccaactcaa aacgtcacag gccctcgcag
2041 aacaatccac catgccagtg ctccactcac ggacaatgac agaagaaacg aaccctccgg
2101 ctcaaccagc cctcgcatgc tgaccccaat caacgaagag gcagacccac tggacgatgc
2161 cgacgacgag acgtctagcc ttccgccctt agagtcagat gatgaagaac aggacaggga
2221 cggaacttct aaccgcacac ccactgtcgc cccaccggct cccgtataca gagatcactc
2281 cgaaaagaaa gaactcccgc aagatgaaca acaagatcag gaccacattc aagaggccag
2341 gaaccaagac agtgacaaca cccagccaga acattctttt gaggagatgt atcgccacat
2401 tctaagatca caggggccat ttgatgccgt tttgtattat catatgatga aggatgagcc
2461 tgtagttttc agtaccagtg atggtaaaga gtacacgtat ccggactccc ttgaagagga
2521 atatccacca tggctcactg aaaaagaggc catgaatgat gagaatagat ttgttacact
2581 ggatggtcaa caattttatt ggccagtaat gaatcacagg aataaattca tggcaatcct
2641 gcaacatcat cagtgaatga gcatgtaata atgggatgat ttaatcgaca aatagctaac
2701 attaaatagt caaggaacgc aaacaggaag aatttttgat gtctaaggtg tgaattatta
2761 tcacaataaa agtgattctt agttttgaat ttaaagctag cttattatta ctagccgttt
2821 ttcaaagttc aatttgagtc ttaatgcaaa taagcgttaa gccacagtta tagccataat
2881 ggtaactcaa tatcttagcc agcgatttat ctaaattaaa ttacattatg cttttataac
2941 ttacctacta gcctgcccaa catttacacg atcgttttat aattaagaaa aaactaatga
3001 tgaagattaa aaccttcatc atccttacgt caattgaatt ctctagcact agaagcttat
3061 tgtcttcaat gtaaaagaaa agctggccta acaagatgac aactagaaca aagggcaggg
3121 gccatactgt ggccacgact caaaacgaca gaatgccagg ccctgagctt tcgggctgga
3181 tctctgagca gctaatgacc ggaaggattc ctgtaaacga catcttctgt gatattgaga
3241 acaatccagg attatgctac gcatcccaaa tgcaacaaac gaagccaaac ccgaagatgc
3301 gcaacagtca aacccaaacg gacccaattt gcaatcatag ttttgaggag gtagtacaaa
3361 cattggcttc attggctact gttgtgcaac aacaaaccat cgcatcagaa tcattagaac
3421 aacgcattac gagtcttgag aatggtctaa agccagttta tgatatggca aaaacaatct
3481 cctcattgaa cagggtttgt gctgagatgg ttgcaaaata tgatcttctg gtgatgacaa
3541 ccggtcgggc aacagcaacc gctgcggcaa ctgaggctta ttgggctgaa catggtcaac
3601 caccacctgg accatcactt tatgaagaaa gtgcgattcg gggtaagatt gaatctagag
3661 atgagactgt ccctcaaagt gttagggagg cattcaacaa tctagacagt accacttcac
3721 taactgagga aaattttggg aaacctgaca tttcggcaaa ggatttgaga aacattatgt
3781 atgatcactt gcctggtttt ggaactgctt tccaccaatt agtacaagtg atttgtaaat
3841 tgggaaaaga tagcaattca ttggacatta ttcatgctga gttccaggcc agcctggctg
3901 aaggagactc ccctcaatgt gccctaattc aaattacaaa aagagttcca atcttccaag
3961 atgctgctcc acctgtcatc cacatccgct ctcgaggtga cattccccga gcttgccaga
4021 agagcttgcg tccagtccca ccatcaccca agattgatcg aggttgggta tgtgtttttc
4081 agcttcaaga tggtaaaaca cttggactca aaatttgagc caatctcttt tccctccgaa
4141 agaggcaact aatagcagag gcttcaactg ctgaactata gggtatgtta cattaatgat
4201 acacttgtga gtatcagccc tagataatat aagtcaatta aacaaccaag ataaaattgt
4261 tcatatcccg ctagcagctt taaagataaa tgtaatagga gctatacctc tgacagtatt
4321 ataattaatt gttattaagt aacccaaacc aaaaatgatg aagattaaga aaaacctacc
4381 tcgactgaga gagtgttttt tcattaacct tcatcttgta aacgttgagc aaaattgtta
4441 aaaatatgag gcgggttata ttgcctactg ctcctcctga atatatggag gccatatacc
4501 ctgccaggtc aaattcaaca attgctaggg gtggcaacag caatacaggc ttcctgacac
4561 cggagtcagt caatggagac actccatcga atccactcag gccaattgct gatgacacca
4621 tcgaccatgc cagccacaca ccaggcagtg tgtcatcagc attcatcctc gaagctatgg
4681 tgaatgtcat atcgggcccc aaagtgctaa tgaagcaaat tccaatttgg cttcctctag
4741 gtgtcgctga tcaaaagacc tacagctttg actcaactac ggccgccatc atgcttgctt
4801 catatactat cacccatttc ggcaaggcaa ccaatccgct tgtcagagtc aatcggctgg
4861 gtcctggaat cccggatcac cccctcaggc tcctgcgaat tggaaaccag gctttcctcc
4921 aggagttcgt tcttccacca gtccaactac cccagtattt cacctttgat ttgacagcac
4981 tcaaactgat cactcaacca ctgcctgctg caacatggac cgatgacact ccaactggat
5041 caaatggagc gttgcgtcca ggaatttcat ttcatccaaa acttcgcccc attcttttac
5101 ccaacaaaag tgggaagaag gggaacagtg ccgatctaac atctccggag aaaatccaag
5161 caataatgac ttcactccag gactttaaga tcgttccaat tgatccaacc aaaaatatca
5221 tgggtatcga agtgccagaa actctggtcc acaagctgac cggtaagaag gtgacttcca
5281 aaaatggaca accaatcatc cctgttcttt tgccaaagta cattgggttg gacccggtgg
5341 ctccaggaga cctcaccatg gtaatcacac aggattgtga cacgtgtcat tctcctgcaa
5401 gtcttccagc tgtggttgag aagtaattgc aataattgac tcagatccag ttttacagaa
5461 tcttctcagg gatagtgata acatcttttt aataatccgt ctactagaag agatacttct
5521 aattgatcaa tatactaaag gtgctttaca ccattgtctc ttttctctcc taaatgtaga
5581 gcttaacaaa agactcataa tatacctgtt tttaaaagat tgattgatga aagatcatga
5641 ctaataacat tacaaacaat cctactataa tcaatacggt gattcaaatg tcaatctttc
5701 tcattgcaca tactctttgt ccttatcctc aaattgccta catgcttaca tctgaggaca
5761 gccagtgtga cttggattgg agatgtggag gaaaaatcgg ggcccatttc taagttgttc
5821 acaatctaag tacagacatt gctcttctaa ttaagaaaaa atcggcgatg aagattaagc
5881 cgacagtgag cgtaatcttc atctctctta gattatttgt cttccagagt aggggtcatc
5941 aggtcctttt caattggata accaaaataa gcttcactag aaggatattg tgaggcgaca
6001 acacaatggg tgttacagga atattgcagt tacctcgtga tcgattcaag aggacatcat
6061 tctttctttg ggtaattatc cttttccaaa gaacattttc catcccgctt ggagttatcc
6121 acaatagtac attacaggtt agtgatgtcg acaaactagt ttgtcgtgac aaactgtcat
6181 ccacaaatca attgagatca gttggactga atctcgaggg gaatggagtg gcaactgacg
6241 tgccatctgt gactaaaaga tggggcttca ggtccggtgt cccaccaaag gtggtcaatt
6301 atgaagctgg tgaatgggct gaaaactgct acaatcttga aatcaaaaaa cctgacggga
6361 gtgagtgtct accagcagcg ccagacggga ttcggggctt cccccggtgc cggtatgtgc
6421 acaaagtatc aggaacggga ccatgtgccg gagactttgc cttccacaaa gagggtgctt
6481 tcttcctgta tgatcgactt gcttccacag ttatctaccg aggaacgact ttcgctgaag
6541 gtgtcgttgc atttctgata ctgccccaag ctaagaagga cttcttcagc tcacacccct
6601 tgagagagcc ggtcaatgca acggaggacc cgtcgagtgg ctattattct accacaatta
6661 gatatcaggc taccggtttt ggaactaatg agacagagta cttgttcgag gttgacaatt
6721 tgacctacgt ccaacttgaa tcaagattca caccacagtt tctgctccag ctgaatgaga
6781 caatatatgc aagtgggaag aggagcaaca ccacgggaaa actaatttgg aaggtcaacc
6841 ccgaaattga tacaacaatc ggggagtggg ccttctggga aactaaaaaa acctcactag
6901 aaaaattcgc agtgaagagt tgtctttcac agctgtatca aacggaccca aaaacatcag
6961 tggtcagagt ccggcgcgaa cttcttccga cccagagacc aacacaacaa atgaagacca
7021 caaaatcatg gcttcagaaa attcctctgc aatggttcaa gtgcacagtc aaggaaggaa
7081 agctgcagtg tcgcatctga caacccttgc cacaatctcc acgagtcctc aacctcccac
7141 aaccaaaaca ggtccggaca acagcaccca taatacaccc gtgtataaac ttgacatctc
7201 tgaggcaact caagttggac aacatcaccg tagagcagac aacgacagca cagcctccga
7261 cactcccccc gccacgaccg cagccggacc cttaaaagca gagaacacca acacgagtaa
7321 gagcgctgac tccctggacc tcgccaccac gacaagcccc caaaactaca gcgagactgc
7381 tggcaacaac aacactcatc accaagatac cggagaagag agtgccagca gcgggaagct
7441 aggcttaatt accaatacta ttgctggagt agcaggactg atcacaggcg ggagaaggac
7501 tcgaagagaa gtaattgtca atgctcaacc caaatgcaac cccaatttac attactggac
7561 tactcaggat gaaggtgctg caatcggatt ggcctggata ccatatttcg ggccagcagc
7621 cgaaggaatt tacacagagg ggctaatgca caaccaagat ggtttaatct gtgggttgag
7681 gcagctggcc aacgaaacga ctcaagctct ccaactgttc ctgagagcca caactgagct
7741 gcgaaccttt tcaatcctca accgtaaggc aattgacttc ctgctgcagc gatggggtgg
7801 cacatgccac attttgggac cggactgctg tatcgaacca catgattgga ccaagaacat
7861 aacagacaaa attgatcaga ttattcatga ttttgttgat aaaacccttc cggaccaggg
7921 ggacaatgac aattggtgga caggatggag acaatggata ccggcaggta ttggagttac
7981 aggtgttata attgcagtta tcgctttatt ctgtatatgc aaatttgtct tttagtcttt
8041 cttcagattg tttcacggca aaactcaacc tcaaatcaat gaaactagga tttaattata
8101 tgaatcactt gaatctaaga ttacttgaca aatgataaca taatacactg gagcttcaaa
8161 catagccaat gtgattctaa ctcctttaaa ctcacagtta atcataaaca aggtttgaca
8221 tcaatctagc tatatcttta agaatgataa acttgatgaa gattaagaaa aaggtaatct
8281 ttcgattatc tttagtcttc atccttgatt ctacaatcat gacagttgtc tttaatgaaa
8341 aaggaaaaaa gcctttttat taagttgtaa taatcagatc tgcaaaccgg tagaatttag
8401 ttgtaaccta acacacacaa agcattggta aaaaagtcaa tagaaattta aacagtgagt
8461 gcagacaact cttaaatgga agcttcatat gagagaggac gcccccgagc tgccagacag
8521 cattcaaggg atggacacga ccaccatgtt cgagcacgat catcatccag agagaattat
8581 cgaggtgagt accgtcaatc aaggagcgcc tcacaagtgc gcgttcctac tgtatttcat
8641 aagaagagag ttgaaccatt aacagttcct ccagcaccta aagacatatg tccgaccttg
8701 aaaaaaggat ttttgtgtga cagtagtttt tgcaaaaaag accaccagtt agaaagttta
8761 actgataggg aattactcct actaatcgcc cgtaagactt gtggatcagt agaacaacaa
8821 ttaaatataa ctgcacccaa ggactcgcgc ttagcaaatc caacggctga tgatttccag
8881 caagaggaag gtccaaaaat taccttgttg acactgatca agacggcaga acactgggcg
8941 agacaagaca tccgaaccat agaggattcc aaattaaggg cattgttaac tctatgtgct
9001 gtgatgacga ggaaattctc aaaatcccag ctgagtcttt tgtgtgagac acacctaagg
9061 cgcgaagggc ttgggcaaga tcaggcagaa cccgttctcg aagtatatca acgattacac
9121 agtgataaag gaggcagttt tgaagctgca ctatggcaac aatgggaccg acaatcccta
9181 attatgttta tcactgcatt cttgaatatc gctctccagt taccgtgtga aagttctgct
9241 gtcgttgttt cagggttaag aacattggtt cctcaatcag ataatgagga agcttcaacc
9301 aacccgggga catgctcatg gtctgatgag ggtacccctt aataaggctg actaaaacac
9361 tatataacct tctacttgat cacaatactc cgtataccta tcatcatata tttaatcaag
9421 acgatatcct ttaaaactta ttcagtacta taatcactct catttcaaat tgataagata
9481 tgcataattg ccttaatata tagagaggta tgatataacc caaacattga ccaaagaaaa
9541 tcataatctc gtatcgctcg caatataacc tgccaagcat acctcttgca caaagtgatt
9601 cttgtacaca aataatgttt gactctacag gaggtagcaa cgatccatct catcaaaaaa
9661 taagtatttt atgatttact aatgatctct taaaatatta agaaaaactg acggaacata
9721 aattctttct gcttcaagtt gtggaggagg tctatggtat tcgctattgt tatattacaa
9781 tcaataacaa gcttgtaaaa atattgttct tgtttcagga ggtatattgt gaccggaaaa
9841 gctaaactaa tgatgaagat taatgcggag gtctgatgag aataaacctt attattcaga
9901 ttaggcccca agaggcattc ttcatctcct tttagcaaaa tactatttca ggatagtcca
9961 gctagtgaca cgtcttttag ctgtatacca gttgcccctg agatacgcca caaaagtgtc
10021 tctgagctaa agtggtctgt acacatctca tacattgtat taggggcaat aatatctaat
10081 tgaacttagc catttaaaat ttagtgcata aatctgggct aactccacca ggtcaactcc
10141 attggctgaa aagaagccca cctacaacga acattacttt gagcgccctc acaattaaaa
10201 aataagagcg tcgttccaac aatcgagcgc aaggttacaa ggttgaactg agagtgtcta
10261 gacaacaaaa tatcgatact ccagacacca agcaagacct gagaaaaaac catggccaaa
10321 gctacgggac gatacaatct aatatcgccc aaaaaggacc tggagaaagg ggttgtctta
10381 agcgacctct gtaacttctt agttagtcaa actattcaag ggtggaaagt ttattgggct
10441 ggtattgagt ttgatgtgac tcacaaagga atggccctat tgcatagact gaaaactaat
10501 gactttgccc ctgcatggtc aatgacaagg aacctatttc cccatttatt tcaaaatccg
10561 aattccacta ttgaatcacc gctgtgggca ctgagagtca tccttgcagc agggatacag
10621 gaccagttaa ttgaccagtc tttgattgaa cccttagcag gagcccttgg tctgatctct
10681 gattggctgc taacaaccaa cactaaccat ttcaacatgc gaacacaacg tgtcaaggaa
10741 caattgagcc taaaaatgct gtcgttgatt cgatccaata ttctcaagtt tattaacaaa
10801 ttggatgctc tacatgtcgt gaactacaat ggattattga gcagtattga aattggaact
10861 caaaatcata caatcatcat aactcgaact aacatgggtt ttctggtgga gctccaagaa
10921 cccgacaaat cggcaatgaa ccgcaagaag cctgggccgg cgaaattttc cctccttcat
10981 gagtccacac tgaaagcatt tacacaaggg tcctcgacac gaatgcaaag tttaattctt
11041 gaattcaata gctctcttgc tatctaacta agatggaata cttcatattg ggctaactca
11101 tatatgctga ctcaatagtt aacttgacat ctctgccttc ataatcagat atataagcat
11161 aataaataaa tactcatatt tcttgataat ttgtttaacc acagataaat cctcactgta
11221 agccagcttc caagttgaca cccttacaaa aaccaggact cagaatccct caaataagag
11281 attccaagac aacatcatag aattgcttta ttatattaat aagcatttta tcactagaaa
11341 tccaatatac gaaatggtta attgtaacta aacccgcagg tcatgtgtgt taggtttcac
11401 aaattatata tattactaac tccatactcg taactaacat tagataagta ggttaagaaa
11461 aaagcttgag gaagattaag aaaaactgct tattgggtct ttccgtgttt tagatgaagc
11521 agttgacatt cttcctcttg atattaaatg gctacacaac atacccaata cccagacgcc
11581 aggttatcat caccaattgt attggaccaa tgtgaccttg tcactagagc ttgcgggttg
11641 tattcatcat actcccttaa tccgcaacta cgcaactgta aactcccgaa acatatatac
11701 cgtttaaaat atgatgtaac tgttaccaag ttcttaagtg atgtaccagt ggcgacattg
11761 cccatagatt tcatagtccc aattcttctc aaggcactat caggcaatgg gttctgtcct
11821 gttgagccgc ggtgccaaca gttcttagat gaaattatta agtacacaat gcaagatgct
11881 ctcttcctga aatattatct caaaaatgtg ggtgctcaag aagactgtgt tgatgaccac
11941 tttcaagaaa aaatcttatc ttcaattcag ggcaatgaat ttttacatca aatgtttttc
12001 tggtatgacc tggctatttt aactcgaagg ggtagattaa atcgaggaaa ctctagatca
12061 acgtggtttg ttcatgatga tttaatagac atcttaggct atggggacta tgttttttgg
12121 aagatcccaa tttcactgtt accactgaac acacaaggaa tcccccatgc tgctatggat
12181 tggtatcaga catcagtatt caaagaagcg gttcaagggc atacacacat tgtttctgtt
12241 tctactgccg atgtcttgat aatgtgcaaa gatttaatta catgtcgatt caacacaact
12301 ctaatctcaa aaatagcaga ggttgaggac ccagtttgct ctgattatcc caattttaag
12361 attgtgtcta tgctttacca gagcggagat tacttactct ccatattagg gtctgatggg
12421 tataaaatca ttaagtttct cgaaccattg tgcttggcta aaattcaatt gtgctcaaag
12481 tacaccgaga ggaagggccg attcttaaca caaatgcatt tagctgtaaa tcacaccctg
12541 gaagaaatta cagaaatacg tgcactaaag ccttcacagg ctcacaagat ccgtgaattc
12601 catagaacat tgataaggct ggagatgacg ccacaacaac tttgtgagct attttccata
12661 caaaaacact gggggcatcc tgtgctacat agtgaaacag caatccaaaa agttaaaaaa
12721 catgctacgg tgctaaaagc attacgccct atcgtgattt tcgagacata ttgtgttttt
12781 aaatatagca ttgcaaaaca ttattttgat agtcaaggat cttggtacag tgttacctca
12841 gatagaaatc taacaccagg tcttaattct tatatcaaaa gaaatcaatt ccctccgttg
12901 ccaatgatta aagaactgct atgggaattt taccaccttg accatcctcc acttttctca
12961 accaaaatta ttagtgactt aagtattttt ataaaagaca gagctactgc agtagaaagg
13021 acatgctggg atgcagtatt cgagcctaat gttctgggat ataatccacc tcacaaattc
13081 agtaccaaac gtgtaccgga acaattttta gagcaagaaa acttttctat tgagaatgtt
13141 ctttcctacg cgcaaaaact cgagtatcta ctaccacaat atcggaattt ttctttctca
13201 ttgaaagaga aagagttgaa tgtaggtaga actttcggaa aattgcctta tccgactcgc
13261 aatgttcaaa cactttgtga agctctgtta gctgatggtc ttgctaaagc atttcctagc
13321 aatatgatgg tagttacgga acgtgaacaa aaagaaagct tattgcatca agcatcatgg
13381 caccacacaa gtgatgattt cggtgagcat gccacagtta gagggagtag ctttgtaact
13441 gatttagaga aatacaatct tgcatttagg tatgagttta cagcaccttt tatagaatat
13501 tgcaaccgtt gctatggtgt taagaatgtt tttaattgga tgcattatac aatcccacag
13561 tgttatatgc atgtcagtga ttattataat ccaccgcata acctcacact ggaaaatcga
13621 aacaaccccc ctgaagggcc tagttcatac aggggtcata tgggagggat tgaaggactg
13681 caacaaaaac tctggacaag tatttcatgt gctcaaattt ctttagttga aattaagact
13741 ggttttaagt tgcgctcagc tgtgatgggt gacaatcagt gcattaccgt tttatcagtc
13801 ttccccttag agactgatgc aggcgagcag gaacagagcg ccgaggacaa tgcagcgagg
13861 gtggccgcca gcctagcaaa agttacaagt gcctgtggaa tctttttaaa acctgatgaa
13921 acatttgtac attcaggttt tatctatttt ggaaaaaaac aatatttgaa tggggtccaa
13981 ttgcctcagt cccttaaaac ggctacaaga atggcaccat tgtctgatgc aatttttgat
14041 gatcttcaag ggaccctggc tagtataggt actgcttttg agcgatccat ctctgagaca
14101 cgacatatct ttccttgcag aataaccgca gctttccata cgttcttttc ggtgagaatc
14161 ttgcaatatc atcacctcgg atttaataaa ggttttgacc ttggacagtt aacactcggc
14221 aaacctctgg atttcggaac aatatcattg gcactagcgg taccgcaggt gcttggaggg
14281 ttatccttct tgaatcctga gaaatgtttc taccggaatc taggagatcc agttacctca
14341 ggtttattcc agttaaaaac ttatctccga atgattgaga tggatgattt attcttacct
14401 ttaattgcga agaaccctgg gaactgcact gccattgact ttgtgctaaa tcctagcgga
14461 ttaaatgttc ctgggtcgca agacttaact tcatttctgc gccagattgt acgtaggact
14521 atcaccctaa gtgcgaaaaa caaacttatt aataccttat ttcatgcatc agctgacttc
14581 gaagacgaaa tggtttgtaa gtggctctta tcatcaactc ctgttatgag tcgtttcgca
14641 gccgatatat tttcacgcac gccgagcggg aagcgattgc aaattctagg atacttggaa
14701 ggaacacgca cattattagc ctctaagatc atcaacaata atacagagac gccggttttg
14761 gacagactga ggaagataac attgcaaagg tggagtctat ggtttagtta tcttgatcat
14821 tgtgataata tcctggcgga ggctttaacc caaataactt gcacagttga tttagcacag
14881 atcctgaggg aatattcatg ggcacatatt ttagagggga gacctcttat tggagccaca
14941 ctcccatgta tgattgagca attcaaagtg gtttggctga aaccctacga acaatgtccg
15001 cagtgttcaa atgccaagca acctggtggg aaaccattcg tgtcagtagc agtcaagaaa
15061 catattgtta gtgcatggcc aaatgcatcc cgaataagct ggactatcgg ggatggaatc
15121 ccatacattg gatcaaggac agaagataag atagggcaac ctgctattaa accaaaatgt
15181 ccttccgcag ccttaagaga ggccattgaa ttggcgtccc gtttaacatg ggtaactcaa
15241 ggcagttcga acagtgactt gctaataaaa ccatttttgg aagcacgagt aaatttaagt
15301 gttcaagaaa tacttcaaat gaccccttca cattactcgg gaaatattgt tcataggtac
15361 aacgatcaat acagtcctca ttctttcatg gccaatcgta tgagtaactc agcaacgcga
15421 ttgattgttt ctacaaacac tttaggtgag ttttcaggag gtggccaatc ggcacgcgac
15481 agcaatatta ttttccagaa tgttataaat tatgcagttg cactgttcga tattaaattt
15541 agaaacactg aggctacaga tatccagtat aatcgtgctc accttcatct aactaagtgt
15601 tgcacccggg aggtaccagc tcagtactta acatacacat ctacattgga tttagattta
15661 acaagatacc gagaaaatga attgatttat gacaataatc ctctaaaagg aggactcaat
15721 tgcaatatct catttgataa cccatttttc caaggcaaac agctgaacat tatagaagat
15781 gaccttattc gactgcctca cttatctgga tgggagctag ctaagaccat catgcaatca
15841 attatttcag atagcaataa ttcgtctaca gacccaatta gcagtggaga aacaagatca
15901 ttcactaccc atttcttaac ttatcccaag ataggacttc tgtacagttt tggggccttt
15961 gtaagttatt atcttggcaa tacaattctt cggactaaga aattaacact tgacaatttt
16021 ttatattact taactaccca aattcataat ctaccacatc gctcattgcg aatacttaag
16081 ccaacattca aacatgcaag cgttatgtca cgattaatga gtattgatcc ccatttttct
16141 atttacatag gcggtgctgc aggtgacaga ggactctcag atgcggccag gttatttttg
16201 agaacgtcca tttcatcttt tcttacattt gtaaaggaat ggataattaa tcgcggaaca
16261 attgtccctt tatggatagt atatccatta gagggtcaaa atccaacacc tgttaataat
16321 ttcctccatc agatcgtaga actgctggtg catgattcat caagacacca ggcttttaaa
16381 actaccataa atgatcatgt acatcctcac gacaatcttg tttacacatg taagagtaca
16441 gccagcaatt tcttccatgc gtcattggcg tactggagga gcaggcacag aaacagcaac
16501 cgaaaagact tgacaagaaa ctcttcaact ggatcaagca caaacaacag tgatggtcat
16561 attaagagaa gtcaagaaca aaccaccaga gatccacatg atggcactga acggagtcta
16621 gtcctgcaaa tgagccatga aataaaaaga acgacaattc cacaagagaa cacgcaccag
16681 ggtccgtcgt tccagtcatt tctaagtgac tctgcttgcg gtacagcaaa cccaaaacta
16741 aatttcgata gatcgagaca caatgtgaaa tctcaggatc ataactcagc atccaagagg
16801 gaaggtcatc aaataatctc acatcgtcta gtcctacctt tctttacatt atctcaaggg
16861 acacgccaat taacgtcatc caatgagtca caaacccaag atgagatatc aaagtactta
16921 cggcaattga gatccgtcat tgataccaca gtttattgta ggtttaccgg tatagtctcg
16981 tccatgcatt acaaacttga tgaggtcctt tgggaaatag agaattttaa gtcggctgtg
17041 acgctggcag agggagaagg tgctggtgcc ttactattga ttcagaaata ccaagttaag
17101 accttatttt tcaacacgct agctactgag tccagtatag agtcagaaat agtatcagga
17161 atgactactc ctaggatgct tctacctgtt atgtcaaaat tccataatga ccaaattgag
17221 attattctta acaactcagc aagccaaata acagacataa caaatcctac ttggtttaaa
17281 gaccaaagag caaggctacc taggcaagtc gaggttataa ccatggatgc agagacgaca
17341 gagaatataa acagatcgaa attgtacgaa gctgtacata aattgatctt acaccatgtt
17401 gatcccagcg tattgaaagc agtggtcctt aaagtctttc taagtgatac cgagggtatg
17461 ttatggctaa atgataatct agccccgttt tttgccactg ggtatttaat taagccaata
17521 acgtcaagtg ccaggtctag tgagtggtat ctttgtctga cgaacttctt atcaactaca
17581 cgtaagatgc cacaccaaaa ccatctcagt tgtaagcagg taatacttac ggcattgcaa
17641 ctgcaaattc aacggagccc atactggcta agtcatttaa ctcagtatgc tgactgcgat
17701 ttacatttaa gctatatccg ccttggtttt ccatcattag agaaagtact ataccacagg
17761 tataaccttg tcgattcaaa aagaggtcca ctagtctctg tcactcagca cttagcacat
17821 cttagggcag agattcgaga attgaccaat gattataatc aacagcgaca aagtcggact
17881 caaacatatc actttattcg tactgcaaaa ggacgaatca caaaactagt caatgattat
17941 ttaaaattct ttcttattgt acaagcatta aaacataatg ggacatggca agctgagttt
18001 aagaaattac cagagttgat tagtgtgtgc aataggttct atcatattag agattgtaat
18061 tgtgaagaac gtttcttagt tcaaacctta tatttacata gaatgcagga ttctgaagtt
18121 aagcttatcg aaaggctgac agggcttctg agtttatttc cagatggtct ctacaggttc
18181 gattgaataa ccgtgcatag tattttgata cttgtaaagg ttggttatca acatacagat
18241 tataaaaaac tcataaattg ctctcataca tcatcttgat ctgatttcaa taaataacta
18301 tttagataac gaaaggagtc cttacattat acactatatt tggcctctct ccctgcgtga
18361 taatcaaaaa attcacaata cagcatgtgt gacatattac tgctgcaatg agtctaacgc
18421 aacataataa actccgcact ctttataatt aagctttaac gataggtctg ggctcatatt
18481 gttattgata tagtaatgtt gtatcaatat cttgccagat ggaatagtgc tttggttgat
18541 aacacgactt cttaaaacaa aactgatctt taagattaag ttttttataa ttgtcattgc
18601 tttaatttgt cgatttaaaa atggtgatag ccttaatctt tgtgtaaaat aagagattag
18661 gtgtaataac tttaacattt ttgtctagta agctactatt ccattcagaa tgataaaatt
18721 aaaagaaaag acatgactgt aaaatcagaa ataccttctt tacaatatag cagactagat
18781 aataatcttc gtgttaatga taattaaggc attgaccacg ctcatcagaa ggctcactag
18841 aataaacgtt gcaaaaagga tccctggaaa aatggtcgca cacaaaaatt taaaaataaa
18901 tctatttc

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:08 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM034560 18952 bp cRNA linear VRL 10-JUL-2014
DEFINITION Zaire ebolavirus strain G3682-1, partial genome.
ACCESSION KM034560
VERSION KM034560.1 GI:661348705
KEYWORDS .
SOURCE Zaire ebolavirus (ZEBOV)
ORGANISM Zaire ebolavirus
Viruses; ssRNA negative-strand viruses; Mononegavirales;
Filoviridae; Ebolavirus.
REFERENCE 1 (bases 1 to 18952)
AUTHORS Goba,A., Khan,H., Momoh,M., Jalloh,S., Fullah,M., Kanneh,L.,
Gevao,S., Happi,C., Gire,S.K., Andersen,K., Malboeuf,C.,
Matranga,C., Sealfon,R., Wohl,S., Gladden,A., Yang,X., Winnicki,S.,
Park,D., Qu,J., Sabeti,P. and Garry,R.
CONSRTM Viral Hemorrhagic Fever Consortium
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2014) Infectious Disease Initiative, Broad
Institute of MIT and Harvard, 75 Ames St., Cambridge, MA 02142, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Novoalign v. 3
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..18952
/organism="Zaire ebolavirus"
/mol_type="viral cRNA"
/strain="G3682-1"
/isolate="Koindu-SL"
/isolation_source="serum"
/host="Homo sapiens"
/db_xref="taxon:186538"
/country="Sierra Leone"
/collection_date="01-Jun-2014"
gene 50..3020
/gene="NP"
mRNA 50..3020
/gene="NP"
/product="nucleoprotein"
misc_signal 50..61
/gene="L"
/note="putative transcription start signal"
CDS 464..2683
/gene="NP"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="nucleoprotein"
/protein_id="AIE11896.1"
/db_xref="GI:661348706"
/translation="MDSRPQKVWMTPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVY
QVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGH
GFRFEVKKCDGVKRLEELLPAVSSGRNIKRTLAAMPEEETTEANAGQFLSFASLFLPK
LVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQG
MHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNE
VNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTN
AMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQ
DTTIPDVVVDPDDGGYGEYQSYSENGMSAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQ
KNSQKGQHTEGRQTQSTPTQNVTGPRRTIHHASAPLTDNDRRNEPSGSTSPRMLTPIN
EEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDE
QQDQDHIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSD
GKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ"
polyA_signal 3009..3020
/gene="NP"
gene 3026..4401
/gene="VP35"
mRNA 3026..4401
/gene="VP35"
/product="polymerase complex protein"
misc_signal 3026..3037
/gene="VP35"
/note="putative transcription start signal"
CDS 3123..4145
/gene="VP35"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="polymerase complex protein"
/protein_id="AIE11897.1"
/db_xref="GI:661348707"
/translation="MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIF
CDIENNPGLCYASQMQQTKPNPKMRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTI
ASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATE
AYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPD
ISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGK
TLGLKI"
gene 4384..5888
/gene="VP40"
mRNA 4384..5888
/gene="VP40"
/product="matrix protein"
misc_signal 4384..4395
/gene="VP40"
/note="putative transcription start signal"
polyA_signal 4391..4401
/gene="VP35"
/note="putative"
CDS 4473..5453
/gene="VP40"
/codon_start=1
/product="matrix protein"
/protein_id="AIE11898.1"
/db_xref="GI:661348708"
/translation="MRRVILPTAPPEYMEAIYPARSNSTIARGGNSNTGFLTPESVNG
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVAD
QKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQE
FVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILL
PNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKV
TSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVVEK"
polyA_signal 5877..5888
/gene="VP40"
gene 5894..8299
/gene="GP"
misc_signal 5894..5905
/gene="GP"
/note="putative transcription start signal"
mRNA join(<6033..6917,6917..>8062)
/gene="GP"
/product="virion spike glycoprotein precursor"
/note="ribosomal slippage"
CDS join(6033..6917,6917..8062)
/gene="GP"
/ribosomal_slippage
/note="additional A residue inserted during transcription;
encodes two disulfide linked subunits GP1 and GP2;
receptor binding and fusion"
/codon_start=1
/product="virion spike glycoprotein precursor"
/protein_id="AIE11899.1"
/db_xref="GI:661348709"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNGPKNISGQSPARTSSDPETNT
TNEDHKIMASENSSAMVQVHSQGRKAAVSHLTTLATISTSPQPPTTKTGPDNSTHNTP
VYKLDISEATQVGQHHRRADNDSTASDTPPATTAAGPLKAENTNTSKSADSLDLATTT
SPQNYSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREVIVNAQ
PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETT
QALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKID
QIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF"
mRNA <6033..>7127
/gene="GP"
/product="sGP"
CDS 6033..7127
/gene="GP"
/note="sGP secreted as an anti-parallel oriented
homodimer; small non-structural secreted glycoprotein"
/codon_start=1
/product="sGP"
/protein_id="AIE11900.1"
/db_xref="GI:661348710"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTDPKTSVVRVRRELLPTQRPTQ
QMKTTKSWLQKIPLQWFKCTVKEGKLQCRI"
mRNA join(<6033..6916,6918..>6927)
/gene="GP"
/product="ssGP"
/note="ribosomal slippage"
CDS join(6033..6916,6918..6927)
/gene="GP"
/ribosomal_slippage
/note="one A residue is deleted or two additional A
residues are inserted at the editing site during
transcription; second non-structural secreted
glycoprotein; secreted in a monomeric form"
/codon_start=1
/product="ssGP"
/protein_id="AIE11901.1"
/db_xref="GI:661348711"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKPH"
misc_feature 7520..7534
/gene="GP"
/note="cleavage site; precursor GP is cleaved by
subtilisin-like cellularprotease furin into subunits GP1
and GP2 that are linked by a disulfide bond"
misc_feature 7784..7864
/gene="GP"
/note="immunosuppressive motif"
gene 8282..9734
/gene="VP30"
mRNA 8282..9734
/gene="VP30"
/product="VP30"
misc_signal 8282..8293
/gene="VP30"
/note="putative transcription start signal"
polyA_signal 8289..8299
/gene="GP"
/note="putative"
CDS 8503..9369
/gene="VP30"
/note="minor nucleoprotein; polymerase complex protein"
/codon_start=1
/product="VP30"
/protein_id="AIE11902.1"
/db_xref="GI:661348712"
/translation="MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRS
ASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLL
LIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIR
TIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDK
GGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTN
PGTCSWSDEGTP"
polyA_signal 9724..9734
/gene="VP30"
/note="putative"
gene 9879..11512
/gene="VP24"
/note="putative"
mRNA 9879..11512
/gene="VP24"
/product="VP24"
misc_signal 9879..9890
/gene="VP24"
/note="putative transcription start signal"
CDS 10339..11094
/gene="VP24"
/note="membrane-associated protein"
/codon_start=1
/product="VP24"
/protein_id="AIE11903.1"
/db_xref="GI:661348713"
/translation="MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAG
IEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGI
QDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKF
INKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRKKPGPAK
FSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI"
polyA_signal 11479..11490
/gene="VP24"
/note="putative"
gene 11495..18276
/gene="L"
mRNA 11495..18276
/gene="L"
/product="polymerase"
misc_signal 11495..11506
/gene="L"
/note="putative transcription start signal"
polyA_signal 11502..11512
/gene="VP24"
/note="putative"
CDS 11575..18213
/gene="L"
/note="involved in synthesis of viral RNAs and
transcriptional RNA editing"
/codon_start=1
/product="polymerase"
/protein_id="AIE11904.1"
/db_xref="GI:661348714"
/translation="MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNC
KLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPILLKALSGNGFCPVEPRCQQFLDE
IIKYTMQDALFLKYYLKNVGAQEDCVDDHFQEKILSSIQGNEFLHQMFFWYDLAILTR
RGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISLLPLNTQGIPHAAMDWYQTSVF
KEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEVEDPVCSDYPNFKIVSML
YQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEI
TEIRALKPSQAHKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKH
ATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPP
LPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPP
HKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKL
PYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATV
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNP
PHNLTLENRNNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVM
GDNQCITVLSVFPLETDAGEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGF
IYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFP
CRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSF
LNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGL
NVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRF
AADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSY
LDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVVWLKP
YEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQ
PAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSH
YSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENE
LIYDNNPLKGGLNCNISFDNPFFQGKQLNIIEDDLIRLPHLSGWELAKTIMQSIISDS
NNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYY
LTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLR
TSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLHQIVELLVHDSSRHQAF
KTTINDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKDLTRNSSTGSSTNNS
DGHIKRSQEQTTRDPHDGTERSLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGT
ANPKLNFDRSRHNVKSQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQ
DEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIENFKSAVTLAEGEGAGAL
LLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQ
ITDITNPTWFKDQRARLPRQVEVITMDAETTENINRSKLYEAVHKLILHHVDPSVLKA
VVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPH
QNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCDLHLSYIRLGFPSLEKVLYHRYNL
VDSKRGPLVSVTQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYL
KFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSE
VKLIERLTGLLSLFPDGLYRFD"
polyA_signal 18266..18276
/gene="L"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:09 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 cacaaaaaga aagaagaatt tttaggatct tttgtgtgcg aataactatg aggaagatta
61 ataattttcc tctcattgaa atttatatcg gaatttaaat tgaaattgtt actgtaatca
121 tacctggttt gtttcagagc catatcacca agatagagaa caacctaggt ctccggaggg
181 ggcaagggca tcagtgtgct cagttgaaaa tcccttgtca acatctaggc cttatcacat
241 cacaagttcc gccttaaact ctgcagggtg atccaacaac cttaatagca acattattgt
301 taaaggacag cattagttca cagtcaaaca agcaagattg agaattaact ttgattttga
361 acctgaacac ccagaggact ggagactcaa caaccctaaa gcctggggta aaacattaga
421 aatagtttaa agacaaattg ctcggaatca caaaattccg agtatggatt ctcgtcctca
481 gaaagtctgg atgacgccga gtctcactga atctgacatg gattaccaca agatcttgac
541 agcaggtctg tccgttcaac aggggattgt tcggcaaaga gtcatcccag tgtatcaagt
601 aaacaatctt gaggaaattt gccaacttat catacaggcc tttgaagctg gtgttgattt
661 tcaagagagt gcggacagtt tccttctcat gctttgtctt catcatgcgt accaaggaga
721 ttacaaactt ttcttggaaa gtggcgcagt caagtatttg gaagggcacg ggttccgttt
781 tgaagtcaag aagtgtgatg gagtgaagcg ccttgaggaa ttgctgccag cagtatctag
841 tgggagaaac attaagagaa cacttgctgc catgccggaa gaggagacga ctgaagctaa
901 tgccggtcag ttcctctcct ttgcaagtct attccttccg aaattggtag taggagaaaa
961 ggcttgcctt gagaaggttc aaaggcaaat tcaagtacat gcagagcaag gactgataca
1021 atatccaaca gcttggcaat cagtaggaca catgatggtg attttccgtt tgatgcgaac
1081 aaattttttg atcaaatttc ttctaataca ccaagggatg cacatggttg ccggacatga
1141 tgccaacgat gctgtgattt caaattcagt ggctcaagct cgtttttcag gtctattgat
1201 tgtcaaaaca gtacttgatc atatcctaca aaagacagaa cgaggagttc gtctccatcc
1261 tcttgcaagg accgccaagg taaaaaatga ggtgaactcc ttcaaggctg cactcagctc
1321 cctggccaag catggagagt atgctccttt cgcccgactt ttgaaccttt ctggagtaaa
1381 taatcttgag catggtcttt tccctcaact gtcggcaatt gcactcggag tcgccacagc
1441 ccacgggagc accctcgcag gagtaaatgt tggagaacag tatcaacagc tcagagaggc
1501 agccactgag gctgagaagc aactccaaca atatgcggag tctcgtgaac ttgaccatct
1561 tggacttgat gatcaggaaa agaaaattct tatgaacttc catcagaaaa agaacgaaat
1621 cagcttccag caaacaaacg cgatggtaac tctaagaaaa gagcgcctgg ccaagctgac
1681 agaagctatc actgctgcat cactgcccaa aacaagtgga cattacgatg atgatgacga
1741 cattcccttt ccaggaccca tcaatgatga cgacaatcct ggccatcaag atgatgatcc
1801 gactgactca caggatacga ccattcccga tgtggtagtt gaccccgatg atggaggcta
1861 cggcgaatac caaagttact cggaaaacgg catgagtgca ccagatgact tggtcctatt
1921 cgatctagac gaggacgacg aggacaccaa gccagtgcct aacagatcga ccaagggtgg
1981 acaacagaaa aacagtcaaa agggccagca tacagagggc agacagacac aatccacgcc
2041 aactcaaaac gtcacaggcc ctcgcagaac aatccaccat gccagtgctc cactcacgga
2101 caatgacaga agaaacgaac cctccggctc aaccagccct cgcatgctga ccccaatcaa
2161 cgaagaggca gacccactgg acgatgccga cgacgagacg tctagccttc cgcccttaga
2221 gtcagatgat gaagaacagg acagggacgg aacttctaac cgcacaccca ctgtcgcccc
2281 accggctccc gtatacagag atcactccga aaagaaagaa ctcccgcaag atgaacaaca
2341 agatcaggac cacattcaag aggccaggaa ccaagacagt gacaacaccc agccagaaca
2401 ttcttttgag gagatgtatc gccacattct aagatcacag gggccatttg atgccgtttt
2461 gtattatcat atgatgaagg atgagcctgt agttttcagt accagtgatg gtaaagagta
2521 cacgtatccg gactcccttg aagaggaata tccaccatgg ctcactgaaa aagaggccat
2581 gaatgatgag aatagatttg ttacactgga tggtcaacaa ttttattggc cagtaatgaa
2641 tcacaggaat aaattcatgg caatcctgca acatcatcag tgaatgagca tgtaataatg
2701 ggatgattta atcgacaaat agctaacatt aaatagtcaa ggaacgcaaa caggaagaat
2761 ttttgatgtc taaggtgtga attattatca caataaaagt gattcttagt tttgaattta
2821 aagctagctt attattacta gccgtttttc aaagttcaat ttgagtctta atgcaaataa
2881 gcgttaagcc acagttatag ccataatggt aactcaatat cttagccagc gatttatcta
2941 aattaaatta cattatgctt ttataactta cctactagcc tgcccaacat ttacacgatc
3001 gttttataat taagaaaaaa ctaatgatga agattaaaac cttcatcatc cttacgtcaa
3061 ttgaattctc tagcactaga agcttattgt cttcaatgta aaagaaaagc tggcctaaca
3121 agatgacaac tagaacaaag ggcaggggcc atactgtggc cacgactcaa aacgacagaa
3181 tgccaggccc tgagctttcg ggctggatct ctgagcagct aatgaccgga aggattcctg
3241 taaacgacat cttctgtgat attgagaaca atccaggatt atgctacgca tcccaaatgc
3301 aacaaacgaa gccaaacccg aagatgcgca acagtcaaac ccaaacggac ccaatttgca
3361 atcatagttt tgaggaggta gtacaaacat tggcttcatt ggctactgtt gtgcaacaac
3421 aaaccatcgc atcagaatca ttagaacaac gcattacgag tcttgagaat ggtctaaagc
3481 cagtttatga tatggcaaaa acaatctcct cattgaacag ggtttgtgct gagatggttg
3541 caaaatatga tcttctggtg atgacaaccg gtcgggcaac agcaaccgct gcggcaactg
3601 aggcttattg ggctgaacat ggtcaaccac cacctggacc atcactttat gaagaaagtg
3661 cgattcgggg taagattgaa tctagagatg agactgtccc tcaaagtgtt agggaggcat
3721 tcaacaatct agacagtacc acttcactaa ctgaggaaaa ttttgggaaa cctgacattt
3781 cggcaaagga tttgagaaac attatgtatg atcacttgcc tggttttgga actgctttcc
3841 accaattagt acaagtgatt tgtaaattgg gaaaagatag caattcattg gacattattc
3901 atgctgagtt ccaggccagc ctggctgaag gagactcccc tcaatgtgcc ctaattcaaa
3961 ttacaaaaag agttccaatc ttccaagatg ctgctccacc tgtcatccac atccgctctc
4021 gaggtgacat tccccgagct tgccagaaga gcttgcgtcc agtcccacca tcacccaaga
4081 ttgatcgagg ttgggtatgt gtttttcagc ttcaagatgg taaaacactt ggactcaaaa
4141 tttgagccaa tctcttttcc ctccgaaaga ggcaactaat agcagaggct tcaactgctg
4201 aactataggg tatgttacat taatgataca cttgtgagta tcagccctag ataatataag
4261 tcaattaaac aaccaagata aaattgttca tatcccgcta gcagctttaa agataaatgt
4321 aataggagct atacctctga cagtattata attaattgtt attaagtaac ccaaaccaaa
4381 aatgatgaag attaagaaaa acctacctcg actgagagag tgttttttca ttaaccttca
4441 tcttgtaaac gttgagcaaa attgttaaaa atatgaggcg ggttatattg cctactgctc
4501 ctcctgaata tatggaggcc atataccctg ccaggtcaaa ttcaacaatt gctaggggtg
4561 gcaacagcaa tacaggcttc ctgacaccgg agtcagtcaa tggagacact ccatcgaatc
4621 cactcaggcc aattgctgat gacaccatcg accatgccag ccacacacca ggcagtgtgt
4681 catcagcatt catcctcgaa gctatggtga atgtcatatc gggccccaaa gtgctaatga
4741 agcaaattcc aatttggctt cctctaggtg tcgctgatca aaagacctac agctttgact
4801 caactacggc cgccatcatg cttgcttcat atactatcac ccatttcggc aaggcaacca
4861 atccgcttgt cagagtcaat cggctgggtc ctggaatccc ggatcacccc ctcaggctcc
4921 tgcgaattgg aaaccaggct ttcctccagg agttcgttct tccaccagtc caactacccc
4981 agtatttcac ctttgatttg acagcactca aactgatcac tcaaccactg cctgctgcaa
5041 catggaccga tgacactcca actggatcaa atggagcgtt gcgtccagga atttcatttc
5101 atccaaaact tcgccccatt cttttaccca acaaaagtgg gaagaagggg aacagtgccg
5161 atctaacatc tccggagaaa atccaagcaa taatgacttc actccaggac tttaagatcg
5221 ttccaattga tccaaccaaa aatatcatgg gtatcgaagt gccagaaact ctggtccaca
5281 agctgaccgg taagaaggtg acttccaaaa atggacaacc aatcatccct gttcttttgc
5341 caaagtacat tgggttggac ccggtggctc caggagacct caccatggta atcacacagg
5401 attgtgacac gtgtcattct cctgcaagtc ttccagctgt ggttgagaag taattgcaat
5461 aattgactca gatccagttt tacagaatct tctcagggat agtgataaca tctttttaat
5521 aatccgtcta ctagaagaga tacttctaat tgatcaatat actaaaggtg ctttacacca
5581 ttgtctcttt tctctcctaa atgtagagct taacaaaaga ctcataatat acctgttttt
5641 aaaagattga ttgatgaaag atcatgacta ataacattac aaacaatcct actataatca
5701 atacggtgat tcaaatgtca atctttctca ttgcacatac tctttgtcct tatcctcaaa
5761 ttgcctacat gcttacatct gaggacagcc agtgtgactt ggattggaga tgtggaggaa
5821 aaatcggggc ccatttctaa gttgttcaca atctaagtac agacattgct cttctaatta
5881 agaaaaaatc ggcgatgaag attaagccga cagtgagcgt aatcttcatc tctcttagat
5941 tatttgtctt ccagagtagg ggtcatcagg tccttttcaa ttggataacc aaaataagct
6001 tcactagaag gatattgtga ggcgacaaca caatgggtgt tacaggaata ttgcagttac
6061 ctcgtgatcg attcaagagg acatcattct ttctttgggt aattatcctt ttccaaagaa
6121 cattttccat cccgcttgga gttatccaca atagtacatt acaggttagt gatgtcgaca
6181 aactagtttg tcgtgacaaa ctgtcatcca caaatcaatt gagatcagtt ggactgaatc
6241 tcgaggggaa tggagtggca actgacgtgc catctgtgac taaaagatgg ggcttcaggt
6301 ccggtgtccc accaaaggtg gtcaattatg aagctggtga atgggctgaa aactgctaca
6361 atcttgaaat caaaaaacct gacgggagtg agtgtctacc agcagcgcca gacgggattc
6421 ggggcttccc ccggtgccgg tatgtgcaca aagtatcagg aacgggacca tgtgccggag
6481 actttgcctt ccacaaagag ggtgctttct tcctgtatga tcgacttgct tccacagtta
6541 tctaccgagg aacgactttc gctgaaggtg tcgttgcatt tctgatactg ccccaagcta
6601 agaaggactt cttcagctca caccccttga gagagccggt caatgcaacg gaggacccgt
6661 cgagtggcta ttattctacc acaattagat atcaggctac cggttttgga actaatgaga
6721 cagagtactt gttcgaggtt gacaatttga cctacgtcca acttgaatca agattcacac
6781 cacagtttct gctccagctg aatgagacaa tatatgcaag tgggaagagg agcaacacca
6841 cgggaaaact aatttggaag gtcaaccccg aaattgatac aacaatcggg gagtgggcct
6901 tctgggaaac taaaaaaacc tcactagaaa aattcgcagt gaagagttgt ctttcacagc
6961 tgtatcaaac ggacccaaaa acatcagtgg tcagagtccg gcgcgaactt cttccgaccc
7021 agagaccaac acaacaaatg aagaccacaa aatcatggct tcagaaaatt cctctgcaat
7081 ggttcaagtg cacagtcaag gaaggaaagc tgcagtgtcg catctgacaa cccttgccac
7141 aatctccacg agtcctcaac ctcccacaac caaaacaggt ccggacaaca gcacccataa
7201 tacacccgtg tataaacttg acatctctga ggcaactcaa gttggacaac atcaccgtag
7261 agcagacaac gacagcacag cctccgacac tccccccgcc acgaccgcag ccggaccctt
7321 aaaagcagag aacaccaaca cgagtaagag cgctgactcc ctggacctcg ccaccacgac
7381 aagcccccaa aactacagcg agactgctgg caacaacaac actcatcacc aagataccgg
7441 agaagagagt gccagcagcg ggaagctagg cttaattacc aatactattg ctggagtagc
7501 aggactgatc acaggcggga gaaggactcg aagagaagta attgtcaatg ctcaacccaa
7561 atgcaacccc aatttacatt actggactac tcaggatgaa ggtgctgcaa tcggattggc
7621 ctggatacca tatttcgggc cagcagccga aggaatttac acagaggggc taatgcacaa
7681 ccaagatggt ttaatctgtg ggttgaggca gctggccaac gaaacgactc aagctctcca
7741 actgttcctg agagccacaa ctgagctgcg aaccttttca atcctcaacc gtaaggcaat
7801 tgacttcctg ctgcagcgat ggggtggcac atgccacatt ttgggaccgg actgctgtat
7861 cgaaccacat gattggacca agaacataac agacaaaatt gatcagatta ttcatgattt
7921 tgttgataaa acccttccgg accaggggga caatgacaat tggtggacag gatggagaca
7981 atggataccg gcaggtattg gagttacagg tgttataatt gcagttatcg ctttattctg
8041 tatatgcaaa tttgtctttt agtctttctt cagattgttt cacggcaaaa ctcaacctca
8101 aatcaatgaa actaggattt aattatatga atcacttgaa tctaagatta cttgacaaat
8161 gataacataa tacactggag cttcaaacat agccaatgtg attctaactc ctttaaactc
8221 acagttaatc ataaacaagg tttgacatca atctagctat atctttaaga atgataaact
8281 tgatgaagat taagaaaaag gtaatctttc gattatcttt agtcttcatc cttgattcta
8341 caatcatgac agttgtcttt aatgaaaaag gaaaaaagcc tttttattaa gttgtaataa
8401 tcagatctgc aaaccggtag aatttagttg taacctaaca cacacaaagc attggtaaaa
8461 aagtcaatag aaatttaaac agtgagtgca gacaactctt aaatggaagc ttcatatgag
8521 agaggacgcc cccgagctgc cagacagcat tcaagggatg gacacgacca ccatgttcga
8581 gcacgatcat catccagaga gaattatcga ggtgagtacc gtcaatcaag gagcgcctca
8641 caagtgcgcg ttcctactgt atttcataag aagagagttg aaccattaac agttcctcca
8701 gcacctaaag acatatgtcc gaccttgaaa aaaggatttt tgtgtgacag tagtttttgc
8761 aaaaaagacc accagttaga aagtttaact gatagggaat tactcctact aatcgcccgt
8821 aagacttgtg gatcagtaga acaacaatta aatataactg cacccaagga ctcgcgctta
8881 gcaaatccaa cggctgatga tttccagcaa gaggaaggtc ccaaaattac cttgttgaca
8941 ctgatcaaga cggcagaaca ctgggcgaga caagacatcc gaaccataga ggattccaaa
9001 ttaagggcat tgttaactct atgtgctgtg atgacgagga aattctcaaa atcccagctg
9061 agtcttttgt gtgagacaca cctaaggcgc gaagggcttg ggcaagatca ggcagaaccc
9121 gttctcgaag tatatcaacg attacacagt gataaaggag gcagttttga agctgcacta
9181 tggcaacaat gggaccgaca atccctaatt atgtttatca ctgcattctt gaatatcgct
9241 ctccagttac cgtgtgaaag ttctgctgtc gttgtttcag ggttaagaac attggttcct
9301 caatcagata atgaggaagc ttcaaccaac ccggggacat gctcatggtc tgatgagggt
9361 accccttaat aaggctgact aaaacactat ataaccttct acttgatcac aatactccgt
9421 atacctatca tcatatattt aatcaagacg atatccttta aaacttattc agtactataa
9481 tcactctcat ttcaaattga taagatatgc ataattgcct taatatataa agaggtatga
9541 tataacccaa acattgacca aagaaaatca taatctcgta tcgctcgcaa tataacctgc
9601 caagcatacc tcttgcacaa agtgattctt gtacacaaat aatgtttgac tctacaggag
9661 gtagcaacga tccatctcat caaaaaataa gtattttatg atttactaat gatctcttaa
9721 aatattaaga aaaactgacg gaacataaat tctttctgct tcaagttgtg gaggaggtct
9781 atggtattcg ctattgttat attacaatca ataacaagct tgtaaaaata ttgttcttgt
9841 ttcaggaggt atattgtgac cggaaaagct aaactaatga tgaagattaa tgcggaggtc
9901 tgatgagaat aaaccttatt attcagatta ggccccaaga ggcattcttc atctcctttt
9961 agcaaaatac tatttcagga tagtccagct agtgacacgt cttttagctg tataccagtt
10021 gcccctgaga tacgccacaa aagtgtctct gagctaaagt ggtctgtaca catctcatac
10081 attgtattag gggcaataat atctaattga acttagccat ttaaaattta gtgcataaat
10141 ctgggctaac tccaccaggt caactccatt ggctgaaaag aagcccacct acaacgaaca
10201 ttactttgag cgccctcaca attaaaaaat aagagcgtcg ttccaacaat cgagcgcaag
10261 gttacaaggt tgaactgaga gtgtctagac aacaaaatat cgatactcca gacaccaagc
10321 aagacctgag aaaaaaccat ggccaaagct acgggacgat acaatctaat atcgcccaaa
10381 aaggacctgg agaaaggggt tgtcttaagc gacctctgta acttcttagt tagtcaaact
10441 attcaagggt ggaaagttta ttgggctggt attgagtttg atgtgactca caaaggaatg
10501 gccctattgc atagactgaa aactaatgac tttgcccctg catggtcaat gacaaggaac
10561 ctatttcccc atttatttca aaatccgaat tccactattg aatcaccgct gtgggcactg
10621 agagtcatcc ttgcagcagg gatacaggac cagttaattg accagtcttt gattgaaccc
10681 ttagcaggag cccttggtct gatctctgat tggctgctaa caaccaacac taaccatttc
10741 aacatgcgaa cacaacgtgt caaggaacaa ttgagcctaa aaatgctgtc gttgattcga
10801 tccaatattc tcaagtttat taacaaattg gatgctctac atgtcgtgaa ctacaatgga
10861 ttattgagca gtattgaaat tggaactcaa aatcatacaa tcatcataac tcgaactaac
10921 atgggttttc tggtggagct ccaagaaccc gacaaatcgg caatgaaccg caagaagcct
10981 gggccggcga aattttccct ccttcatgag tccacactga aagcatttac acaagggtcc
11041 tcgacacgaa tgcaaagttt aattcttgaa ttcaatagct ctcttgctat ctaactaaga
11101 tggaatactt catattgggc taactcatat atgctgactc aatagttaac ttgacatctc
11161 tgccttcata atcagatata taagcataat aaataaatac tcatatttct tgataatttg
11221 tttaaccaca gataaatcct cactgtaagc cagcttccaa gttgacaccc ttacaaaaac
11281 caggactcag aatccctcaa ataagagatt ccaagacaac atcatagaat tgctttatta
11341 tattaataag cattttatca ctagaaatcc aatatacgaa atggttaatt gtaactaaac
11401 ccgcaggtca tgtgtgttag gtttcacaaa ttatatatat tactaactcc atactcgtaa
11461 ctaacattag ataagtaggt taagaaaaaa gcttgaggaa gattaagaaa aactgcttat
11521 tgggtctttc cgtgttttag atgaagcagt tgacattctt cctcttgata ttaaatggct
11581 acacaacata cccaataccc agacgccagg ttatcatcac caattgtatt ggaccaatgt
11641 gaccttgtca ctagagcttg cgggttgtat tcatcatact cccttaatcc gcaactacgc
11701 aactgtaaac tcccgaaaca tatataccgt ttaaaatatg atgtaactgt taccaagttc
11761 ttaagtgatg taccagtggc gacattgccc atagatttca tagtcccaat tcttctcaag
11821 gcactatcag gcaatgggtt ctgtcctgtt gagccgcggt gccaacagtt cttagatgaa
11881 attattaagt acacaatgca agatgctctc ttcctgaaat attatctcaa aaatgtgggt
11941 gctcaagaag actgtgttga tgaccacttt caagaaaaaa tcttatcttc aattcagggc
12001 aatgaatttt tacatcaaat gtttttctgg tatgacctgg ctattttaac tcgaaggggt
12061 agattaaatc gaggaaactc tagatcaacg tggtttgttc atgatgattt aatagacatc
12121 ttaggctatg gggactatgt tttttggaag atcccaattt cactgttacc actgaacaca
12181 caaggaatcc cccatgctgc tatggattgg tatcagacat cagtattcaa agaagcggtt
12241 caagggcata cacacattgt ttctgtttct actgccgatg tcttgataat gtgcaaagat
12301 ttaattacat gtcgattcaa cacaactcta atctcaaaaa tagcagaggt tgaggaccca
12361 gtttgctctg attatcccaa ttttaagatt gtgtctatgc tttaccagag cggagattac
12421 ttactctcca tattagggtc tgatgggtat aaaatcatta agtttctcga accattgtgc
12481 ttggctaaaa ttcaattgtg ctcaaagtac accgagagga agggccgatt cttaacacaa
12541 atgcatttag ctgtaaatca caccctggaa gaaattacag aaatacgtgc actaaagcct
12601 tcacaggctc acaagatccg tgaattccat agaacattga taaggctgga gatgacgcca
12661 caacaacttt gtgagctatt ttccatacaa aaacactggg ggcatcctgt gctacatagt
12721 gaaacagcaa tccaaaaagt taaaaaacat gctacggtgc taaaagcatt acgccctatc
12781 gtgattttcg agacatattg tgtttttaaa tatagcattg caaaacatta ttttgatagt
12841 caaggatctt ggtacagtgt tacctcagat agaaatctaa caccaggtct taattcttat
12901 atcaaaagaa atcaattccc tccgttgcca atgattaaag aactgctatg ggaattttac
12961 caccttgacc atcctccact tttctcaacc aaaattatta gtgacttaag tatttttata
13021 aaagacagag ctactgcagt agaaaggaca tgctgggatg cagtattcga gcctaatgtt
13081 ctgggatata atccacctca caaattcagt accaaacgtg taccggaaca atttttagag
13141 caagaaaact tttctattga gaatgttctt tcctacgcgc aaaaactcga gtatctacta
13201 ccacaatatc ggaatttttc tttctcattg aaagagaaag agttgaatgt aggtagaact
13261 ttcggaaaat tgccttatcc gactcgcaat gttcaaacac tttgtgaagc tctgttagct
13321 gatggtcttg ctaaagcatt tcctagcaat atgatggtag ttacggaacg tgaacaaaaa
13381 gaaagcttat tgcatcaagc atcatggcac cacacaagtg atgatttcgg tgagcatgcc
13441 acagttagag ggagtagctt tgtaactgat ttagagaaat acaatcttgc atttaggtat
13501 gagtttacag caccttttat agaatattgc aaccgttgct atggtgttaa gaatgttttt
13561 aattggatgc attatacaat cccacagtgt tatatgcatg tcagtgatta ttataatcca
13621 ccgcataacc tcacactgga aaatcgaaac aacccccctg aagggcctag ttcatacagg
13681 ggtcatatgg gagggattga aggactgcaa caaaaactct ggacaagtat ttcatgtgct
13741 caaatttctt tagttgaaat taagactggt tttaagttgc gctcagctgt gatgggtgac
13801 aatcagtgca ttaccgtttt atcagtcttc cccttagaga ctgatgcagg cgagcaggaa
13861 cagagcgccg aggacaatgc agcgagggtg gccgccagcc tagcaaaagt tacaagtgcc
13921 tgtggaatct ttttaaaacc tgatgaaaca tttgtacatt caggttttat ctattttgga
13981 aaaaaacaat atttgaatgg ggtccaattg cctcagtccc ttaaaacggc tacaagaatg
14041 gcaccattgt ctgatgcaat ttttgatgat cttcaaggga ccctggctag tataggtact
14101 gcttttgagc gatccatctc tgagacacga catatctttc cttgcagaat aaccgcagct
14161 ttccatacgt tcttttcggt gagaatcttg caatatcatc acctcggatt taataaaggt
14221 tttgaccttg gacagttaac actcggcaaa cctctggatt tcggaacaat atcattggca
14281 ctagcggtac cgcaggtgct tggagggtta tccttcttga atcctgagaa atgtttctac
14341 cggaatctag gagatccagt tacctcaggt ttattccagt taaaaactta tctccgaatg
14401 attgagatgg atgatttatt cttaccttta attgcgaaga accctgggaa ctgcactgcc
14461 attgactttg tgctaaatcc tagcggatta aatgttcctg ggtcgcaaga cttaacttca
14521 tttctgcgcc agattgtacg taggactatc accctaagtg cgaaaaacaa acttattaat
14581 accttatttc atgcatcagc tgacttcgaa gacgaaatgg tttgtaagtg gctcttatca
14641 tcaactcctg ttatgagtcg tttcgcagcc gatatatttt cacgcacgcc gagcgggaag
14701 cgattgcaaa ttctaggata cttggaagga acacgcacat tattagcctc taagatcatc
14761 aacaataata cagagacgcc ggttttggac agactgagga agataacatt gcaaaggtgg
14821 agtctatggt ttagttatct tgatcattgt gataatatcc tggcggaggc tttaacccaa
14881 ataacttgca cagttgattt agcacagatc ctgagggaat attcatgggc acatatttta
14941 gaggggagac ctcttattgg agccacactc ccatgtatga ttgagcaatt caaagtggtt
15001 tggctgaaac cctacgaaca atgtccgcag tgttcaaatg ccaagcaacc tggtgggaaa
15061 ccattcgtgt cagtagcagt caagaaacat attgttagtg catggccaaa tgcatcccga
15121 ataagctgga ctatcgggga tggaatccca tacattggat caaggacaga agataagata
15181 gggcaacctg ctattaaacc aaaatgtcct tccgcagcct taagagaggc cattgaattg
15241 gcgtcccgtt taacatgggt aactcaaggc agttcgaaca gtgacttgct aataaaacca
15301 tttttggaag cacgagtaaa tttaagtgtt caagaaatac ttcaaatgac cccttcacat
15361 tactcgggaa atattgttca taggtacaac gatcaataca gtcctcattc tttcatggcc
15421 aatcgtatga gtaactcagc aacgcgattg attgtttcta caaacacttt aggtgagttt
15481 tcaggaggtg gccaatcggc acgcgacagc aatattattt tccagaatgt tataaattat
15541 gcagttgcac tgttcgatat taaatttaga aacactgagg ctacagatat ccagtataat
15601 cgtgctcacc ttcatctaac taagtgttgc acccgggagg taccagctca gtacttaaca
15661 tacacatcta cattggattt agatttaaca agataccgag aaaatgaatt gatttatgac
15721 aataatcctc taaaaggagg actcaattgc aatatctcat ttgataaccc atttttccaa
15781 ggcaaacagc tgaacattat agaagatgac cttattcgac tgcctcactt atctggatgg
15841 gagctagcta agaccatcat gcaatcaatt atttcagata gcaataattc gtctacagac
15901 ccaattagca gtggagaaac aagatcattc actacccatt tcttaactta tcccaaaata
15961 ggacttctgt acagttttgg ggcctttgta agttattatc ttggcaatac aattcttcgg
16021 actaagaaat taacacttga caatttttta tattacttaa ctacccaaat tcataatcta
16081 ccacatcgct cattgcgaat acttaagcca acattcaaac atgcaagcgt tatgtcacga
16141 ttaatgagta ttgatcccca tttttctatt tacataggcg gtgctgcagg tgacagagga
16201 ctctcagatg cggccaggtt atttttgaga acgtccattt catcttttct tacatttgta
16261 aaggaatgga taattaatcg cggaacaatt gtccctttat ggatagtata tccattagag
16321 ggtcaaaatc caacacctgt taataatttc ctccatcaga tcgtagaact gctggtgcat
16381 gattcatcaa gacaccaggc ttttaaaact accataaatg atcatgtaca tcctcacgac
16441 aatcttgttt acacatgtaa gagtacagcc agcaatttct tccatgcgtc attggcgtac
16501 tggaggagca ggcacagaaa cagcaaccga aaagacttga caagaaactc ttcaactgga
16561 tcaagcacaa acaacagtga tggtcatatt aagagaagtc aagaacaaac caccagagat
16621 ccacatgatg gcactgaacg gagtctagtc ctgcaaatga gccatgaaat aaaaagaacg
16681 acaattccac aagagaacac gcaccagggt ccgtcgttcc agtcatttct aagtgactct
16741 gcttgcggta cagcaaaccc aaaactaaat ttcgatagat cgagacacaa tgtgaaatct
16801 caggatcata actcagcatc caagagggaa ggtcatcaaa taatctcaca tcgtctagtc
16861 ctacctttct ttacattatc tcaagggaca cgccaattaa cgtcatccaa tgagtcacaa
16921 acccaagatg agatatcaaa gtacttacgg caattgagat ccgtcattga taccacagtt
16981 tattgtaggt ttaccggtat agtctcgtcc atgcattaca aacttgatga ggtcctttgg
17041 gaaatagaga attttaagtc ggctgtgacg ctggcagagg gagaaggtgc tggtgcctta
17101 ctattgattc agaaatacca agttaagacc ttattcttca acacgctagc tactgagtcc
17161 agtatagagt cagaaatagt atcaggaatg actactccta ggatgcttct acctgttatg
17221 tcaaaattcc ataatgacca aattgagatt attcttaaca actcagcaag ccaaataaca
17281 gacataacaa atcctacttg gtttaaagac caaagagcaa ggctacctag gcaagtcgag
17341 gttataacca tggatgcaga gacgacagag aatataaaca gatcgaaatt gtacgaagct
17401 gtacataaat tgatcttaca ccatgttgat cccagcgtat tgaaagcagt ggtccttaaa
17461 gtctttctaa gtgataccga gggtatgtta tggctaaatg ataatctagc cccgtttttt
17521 gccactgggt atttaattaa gccaataacg tcaagtgcca ggtctagtga gtggtatctt
17581 tgtctgacga acttcttatc aactacacgt aagatgccac accaaaacca tctcagttgt
17641 aagcaggtaa tacttacggc attgcaactg caaattcaac ggagcccata ctggctaagt
17701 catttaactc agtatgctga ctgcgattta catttaagct atatccgcct tggttttcca
17761 tcattagaga aagtactata ccacaggtat aaccttgtcg attcaaaaag aggtccacta
17821 gtctctgtca ctcagcactt agcacatctt agggcagaga ttcgagaatt gaccaatgat
17881 tataatcaac agcgacaaag tcggactcaa acatatcact ttattcgtac tgcaaaagga
17941 cgaatcacaa aactagtcaa tgattattta aaattctttc ttattgtaca agcattaaaa
18001 cataatggga catggcaagc tgagtttaag aaattaccag agttgattag tgtgtgcaat
18061 aggttctatc atattagaga ttgtaattgt gaagaacgtt tcttagttca aaccttatat
18121 ttacatagaa tgcaggattc tgaagttaag cttatcgaaa ggctgacagg gcttctgagt
18181 ttatttccag atggtctcta caggttcgat tgaataaccg tgcatagtat tttgatactt
18241 gtaaaggttg gttatcaaca tacagattat aaaaaactca taaattgctc tcatacatca
18301 tcttgatctg atttcaataa ataactattt agataacgaa aggagtcctt acattataca
18361 ctatatttgg cctctctccc tgcgtgataa tcaaaaaatt cacaatacag catgtgtgac
18421 atattactgc tgcaatgagt ctaacgcaac ataataaact ccgcactctt tataattaag
18481 ctttaacgat aggtctgggc tcatattgtt attgatatag taatgttgta tcaatatctt
18541 gccagatgga atagtgcttt ggttgataac acgacttctt aaaacaaaac tgatctttaa
18601 gattaagttt tttataattg tcattgcttt aatttgtcga tttaaaaatg gtgatagcct
18661 taatctttgt gtaaaataag agattaggtg taataacttt aacatttttg tctagtaagc
18721 tactattcca ttcagaatga taaaattaaa agaaaagaca tgactgtaaa atcagaaata
18781 ccttctttac aatatagcag actagataat aatcttcgtg ttaatgataa ttaaggcatt
18841 gaccacgctc atcagaaggc tcactagaat aaacgttgca aaaaggatcc ctggaaaaat
18901 ggtcgcacac aaaaatttaa aaataaatct atttcttctt ttttgtgtgt cc

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KM034559 18926 bp cRNA linear VRL 10-JUL-2014
DEFINITION Zaire ebolavirus strain G3680-1, partial genome.
ACCESSION KM034559
VERSION KM034559.1 GI:661348695
KEYWORDS .
SOURCE Zaire ebolavirus (ZEBOV)
ORGANISM Zaire ebolavirus
Viruses; ssRNA negative-strand viruses; Mononegavirales;
Filoviridae; Ebolavirus.
REFERENCE 1 (bases 1 to 18926)
AUTHORS Goba,A., Khan,H., Momoh,M., Jalloh,S., Fullah,M., Kanneh,L.,
Gevao,S., Happi,C., Gire,S.K., Andersen,K., Malboeuf,C.,
Matranga,C., Sealfon,R., Wohl,S., Gladden,A., Yang,X., Winnicki,S.,
Park,D., Qu,J., Sabeti,P. and Garry,R.
CONSRTM Viral Hemorrhagic Fever Consortium
TITLE Direct Submission
JOURNAL Submitted (16-JUN-2014) Infectious Disease Initiative, Broad
Institute of MIT and Harvard, 75 Ames St., Cambridge, MA 02142, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Novoalign v. 3
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..18926
/organism="Zaire ebolavirus"
/mol_type="viral cRNA"
/strain="G3680-1"
/isolate="Koindu-SL"
/isolation_source="serum"
/host="Homo sapiens"
/db_xref="taxon:186538"
/country="Sierra Leone"
/collection_date="01-Jun-2014"
gene 26..2996
/gene="NP"
mRNA 26..2996
/gene="NP"
/product="nucleoprotein"
misc_signal 26..37
/gene="L"
/note="putative transcription start signal"
CDS 440..2659
/gene="NP"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="nucleoprotein"
/protein_id="AIE11887.1"
/db_xref="GI:661348696"
/translation="MDSRPQKVWMTPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVY
QVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGH
GFRFEVKKRDGVKRLEELLPAVSSGRNIKRTLAAMPEEETTEANAGQFLSFASLFLPK
LVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQG
MHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNE
VNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTN
AMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQ
DTTIPDVVVDPDDGGYGEYQSYSENGMSAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQ
KNSQKGQHTEGRQTQSTPTQNVTGPRRTIHHASAPLTDNDRRNEPSGSTSPRMLTPIN
EEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDE
QQDQDHIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSD
GKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ"
polyA_signal 2985..2996
/gene="NP"
gene 3002..4377
/gene="VP35"
mRNA 3002..4377
/gene="VP35"
/product="polymerase complex protein"
misc_signal 3002..3013
/gene="VP35"
/note="putative transcription start signal"
CDS 3099..4121
/gene="VP35"
/note="involved in encapsidation of genomic RNA"
/codon_start=1
/product="polymerase complex protein"
/protein_id="AIE11888.1"
/db_xref="GI:661348697"
/translation="MTTRTKGRGHTVATTQNDRMPGPELSGWISEQLMTGRIPVNDIF
CDIENNPGLCYASQMQQTKPNPKMRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTI
ASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATE
AYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLDSTTSLTEENFGKPD
ISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCA
LIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGK
TLGLKI"
gene 4360..5864
/gene="VP40"
mRNA 4360..5864
/gene="VP40"
/product="matrix protein"
misc_signal 4360..4371
/gene="VP40"
/note="putative transcription start signal"
polyA_signal 4367..4377
/gene="VP35"
/note="putative"
CDS 4449..5429
/gene="VP40"
/codon_start=1
/product="matrix protein"
/protein_id="AIE11889.1"
/db_xref="GI:661348698"
/translation="MRRVILPTAPPEYMEAIYPARSNSTIARGGNSNTGFLTPESVNG
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVAD
QKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQE
FVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILL
PNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKV
TSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVVEK"
polyA_signal 5853..5864
/gene="VP40"
gene 5870..8275
/gene="GP"
misc_signal 5870..5881
/gene="GP"
/note="putative transcription start signal"
mRNA join(<6009..6893,6893..>8038)
/gene="GP"
/product="virion spike glycoprotein precursor"
/note="ribosomal slippage"
CDS join(6009..6893,6893..8038)
/gene="GP"
/ribosomal_slippage
/note="additional A residue inserted during transcription;
encodes two disulfide linked subunits GP1 and GP2;
receptor binding and fusion"
/codon_start=1
/product="virion spike glycoprotein precursor"
/protein_id="AIE11890.1"
/db_xref="GI:661348699"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTAVSNGPKNISGQSPARTSSDPETNT
TNEDHKIMASENSSAMVQVHSQGRKAAVSHLTTLATISTSPQPPTTKTGPDNSTHNTP
VYKLDISEATQVGQHHRRADNDSTASDTPPATTAAGPLKAENTNTSKSADSLDLATTT
SPQNYSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREVIVNAQ
PKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQDGLICGLRQLANETT
QALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKID
QIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF"
mRNA <6009..>7103
/gene="GP"
/product="sGP"
CDS 6009..7103
/gene="GP"
/note="sGP secreted as an anti-parallel oriented
homodimer; small non-structural secreted glycoprotein"
/codon_start=1
/product="sGP"
/protein_id="AIE11891.1"
/db_xref="GI:661348700"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTDPKTSVVRVRRELLPTQRPTQ
QMKTTKSWLQKIPLQWFKCTVKEGKLQCRI"
mRNA join(<6009..6892,6894..>6903)
/gene="GP"
/product="ssGP"
/note="ribosomal slippage"
CDS join(6009..6892,6894..6903)
/gene="GP"
/ribosomal_slippage
/note="one A residue is deleted or two additional A
residues are inserted at the editing site during
transcription; second non-structural secreted
glycoprotein; secreted in a monomeric form"
/codon_start=1
/product="ssGP"
/protein_id="AIE11892.1"
/db_xref="GI:661348701"
/translation="MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQ
VSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFF
LYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTI
RYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASGKRSNTTGKLIWK
VNPEIDTTIGEWAFWETKKPH"
misc_feature 7496..7510
/gene="GP"
/note="cleavage site; precursor GP is cleaved by
subtilisin-like cellularprotease furin into subunits GP1
and GP2 that are linked by a disulfide bond"
misc_feature 7760..7840
/gene="GP"
/note="immunosuppressive motif"
gene 8258..9710
/gene="VP30"
mRNA 8258..9710
/gene="VP30"
/product="VP30"
misc_signal 8258..8269
/gene="VP30"
/note="putative transcription start signal"
polyA_signal 8265..8275
/gene="GP"
/note="putative"
CDS 8479..9345
/gene="VP30"
/note="minor nucleoprotein; polymerase complex protein"
/codon_start=1
/product="VP30"
/protein_id="AIE11893.1"
/db_xref="GI:661348702"
/translation="MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRS
ASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLL
LIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIR
TIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDK
GGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTN
PGTCSWSDEGTP"
polyA_signal 9700..9710
/gene="VP30"
/note="putative"
gene 9855..11488
/gene="VP24"
/note="putative"
mRNA 9855..11488
/gene="VP24"
/product="VP24"
misc_signal 9855..9866
/gene="VP24"
/note="putative transcription start signal"
CDS 10315..11070
/gene="VP24"
/note="membrane-associated protein"
/codon_start=1
/product="VP24"
/protein_id="AIE11894.1"
/db_xref="GI:661348703"
/translation="MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAG
IEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGI
QDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKF
INKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRKKPGPAK
FSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI"
polyA_signal 11455..11466
/gene="VP24"
/note="putative"
gene 11471..18252
/gene="L"
mRNA 11471..18252
/gene="L"
/product="polymerase"
misc_signal 11471..11482
/gene="L"
/note="putative transcription start signal"
polyA_signal 11478..11488
/gene="VP24"
/note="putative"
CDS 11551..18189
/gene="L"
/note="involved in synthesis of viral RNAs and
transcriptional RNA editing"
/codon_start=1
/product="polymerase"
/protein_id="AIE11895.1"
/db_xref="GI:661348704"
/translation="MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNC
KLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPILLKALSGNGFCPVEPRCQQFLDE
IIKYTMQDALFLKYYLKNVGAQEDCVDDHFQEKILSSIQGNEFLHQMFFWYDLAILTR
RGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISLLPLNTQGIPHAAMDWYQTSVF
KEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEVEDPVCSDYPNFKIVSML
YQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEI
TEIRALKPSQAHKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKH
ATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPP
LPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPP
HKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKL
PYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATV
RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNP
PHNLTLENRNNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVM
GDNQCITVLSVFPLETDAGEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGF
IYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFP
CRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSF
LNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGL
NVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRF
AADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSY
LDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVVWLKP
YEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQ
PAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSH
YSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVI
NYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENE
LIYDNNPLKGGLNCNISFDNPFFQGKQLNIIEDDLIRLPHLSGWELAKTIMQSIISDS
NNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYY
LTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLR
TSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLHQIVELLVHDSSRHQAF
KTTINDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKDLTRNSSTGSSTNNS
DGHIKRSQEQTTRDPHDGTERSLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGT
ANPKLNFDRSRHNVKSQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQ
DEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIENFKSAVTLAEGEGAGAL
LLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQ
ITDITNPTWFKDQRARLPRQVEVITMDAETTENINRSKLYEAVHKLILHHVDPSVLKA
VVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPH
QNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCDLHLSYIRLGFPSLEKVLYHRYNL
VDSKRGPLVSVTQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYL
KFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSE
VKLIERLTGLLSLFPDGLYRFD"
polyA_signal 18242..18252
/gene="L"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Jul 27, 2014 8:22 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 ggatcttttg tgtgcgaata actatgagga agattaataa ttttcctctc attgaaattt
61 atatcggaat ttaaattgaa attgttactg taatcatacc tggtttgttt cagagccata
121 tcaccaagat agagaacaac ctaggtctcc ggagggggca agggcatcag tgtgctcagt
181 tgaaaatccc ttgtcaacat ctaggcctta tcacatcaca agttccgcct taaactctgc
241 agggtgatcc aacaacctta atagcaacat tattgttaaa ggacagcatt agttcacagt
301 caaacaagca agattgagaa ttaactttga ttttgaacct gaacacccag aggactggag
361 actcaacaac cctaaagcct ggggtaaaac attagaaata gtttaaagac aaattgctcg
421 gaatcacaaa attccgagta tggattctcg tcctcagaaa gtctggatga cgccgagtct
481 cactgaatct gacatggatt accacaagat cttgacagca ggtctgtccg ttcaacaggg
541 gattgttcgg caaagagtca tcccagtgta tcaagtaaac aatcttgagg aaatttgcca
601 acttatcata caggcctttg aagctggtgt tgattttcaa gagagtgcgg acagtttcct
661 tctcatgctt tgtcttcatc atgcgtacca aggagattac aaacttttct tggaaagtgg
721 cgcagtcaag tatttggaag ggcacgggtt ccgttttgaa gtcaagaagc gtgatggagt
781 gaagcgcctt gaggaattgc tgccagcagt atctagtggg agaaacatta agagaacact
841 tgctgccatg ccggaagagg agacgactga agctaatgcc ggtcagttcc tctcctttgc
901 aagtctattc cttccgaaat tggtagtagg agaaaaggct tgccttgaga aggttcaaag
961 gcaaattcaa gtacatgcag agcaaggact gatacaatat ccaacagctt ggcaatcagt
1021 aggacacatg atggtgattt tccgtttgat gcgaacaaat tttttgatca aatttcttct
1081 aatacaccaa gggatgcaca tggttgccgg acatgatgcc aacgatgctg tgatttcaaa
1141 ttcagtggct caagctcgtt tttcaggtct attgattgtc aaaacagtac ttgatcatat
1201 cctacaaaag acagaacgag gagttcgtct ccatcctctt gcaaggaccg ccaaggtaaa
1261 aaatgaggtg aactccttca aggctgcact cagctccctg gccaagcatg gagagtatgc
1321 tcctttcgcc cgacttttga acctttctgg agtaaataat cttgagcatg gtcttttccc
1381 tcaactgtcg gcaattgcac tcggagtcgc cacagcccac gggagcaccc tcgcaggagt
1441 aaatgttgga gaacagtatc aacagctcag agaggcagcc actgaggctg agaagcaact
1501 ccaacaatat gcggagtctc gtgaacttga ccatcttgga cttgatgatc aggaaaagaa
1561 aattcttatg aacttccatc agaaaaagaa cgaaatcagc ttccagcaaa caaacgcgat
1621 ggtaactcta agaaaagagc gcctggccaa gctgacagaa gctatcactg ctgcatcact
1681 gcccaaaaca agtggacatt acgatgatga tgacgacatt ccctttccag gacccatcaa
1741 tgatgacgac aatcctggcc atcaagatga tgatccgact gactcacagg atacgaccat
1801 tcccgatgtg gtagttgacc ccgatgatgg aggctacggc gaataccaaa gttactcgga
1861 aaacggcatg agtgcaccag atgacttggt cctattcgat ctagacgagg acgacgagga
1921 caccaagcca gtgcctaaca gatcgaccaa gggtggacaa cagaaaaaca gtcaaaaggg
1981 ccagcataca gagggcagac agacacaatc cacgccaact caaaacgtca caggccctcg
2041 cagaacaatc caccatgcca gtgctccact cacggacaat gacagaagaa acgaaccctc
2101 cggctcaacc agccctcgca tgctgacccc aatcaacgaa gaggcagacc cactggacga
2161 tgccgacgac gagacgtcta gccttccgcc cttagagtca gatgatgaag aacaggacag
2221 ggacggaact tctaaccgca cacccactgt cgccccaccg gctcccgtat acagagatca
2281 ctccgaaaag aaagaactcc cgcaagatga acaacaagat caggaccaca ttcaagaggc
2341 caggaaccaa gacagtgaca acacccagcc agaacattct tttgaggaga tgtatcgcca
2401 cattctaaga tcacaggggc catttgatgc cgttttgtat tatcatatga tgaaggatga
2461 gcctgtggtt ttcagtacca gtgatggtaa agagtacacg tatccggact cccttgaaga
2521 ggaatatcca ccatggctca ctgaaaaaga ggccatgaat gatgagaata gatttgttac
2581 actggatggt caacaatttt attggccagt aatgaatcac aggaataaat tcatggcaat
2641 cctgcaacat catcagtgaa tgagcatgta ataatgggat gatttaatcg acaaatagct
2701 aacattaaat agtcaaggaa cgcaaacagg aagaattttt gatgtctaag gtgtgaatta
2761 ttatcacaat aaaagtgatt cttagttttg aatttaaagc tagcttatta ttactagccg
2821 tttttcaaag ttcaatttga gtcttaatgc aaataagcgt taagccacag ttatagccat
2881 aatggtaact caatatctta gccagcgatt tatctaaatt aaattacatt atgcttttat
2941 aacttaccta ctagcctgcc caacatttac acgatcgttt tataattaag aaaaaactaa
3001 tgatgaagat taaaaccttc atcatcctta cgtcaattga attctctagc actagaagct
3061 tattgtcttc aatgtaaaag aaaagctggc ctaacaagat gacaactaga acaaagggca
3121 ggggccatac tgtggccacg actcaaaacg acagaatgcc aggccctgag ctttcgggct
3181 ggatctctga gcagctaatg accggaagga ttcctgtaaa cgacatcttc tgtgatattg
3241 agaacaatcc aggattatgc tacgcatccc aaatgcaaca aacgaagcca aacccgaaga
3301 tgcgcaacag tcaaacccaa acggacccaa tttgcaatca tagttttgag gaggtagtac
3361 aaacattggc ttcattggct actgttgtgc aacaacaaac catcgcatca gaatcattag
3421 aacaacgcat tacgagtctt gagaatggtc taaagccagt ttatgatatg gcaaaaacaa
3481 tctcctcatt gaacagggtt tgtgctgaga tggttgcaaa atatgatctt ctggtgatga
3541 caaccggtcg ggcaacagca accgctgcgg caactgaggc ttattgggct gaacatggtc
3601 aaccaccacc tggaccatca ctttatgaag aaagtgcgat tcggggtaag attgaatcta
3661 gagatgagac tgtccctcaa agtgttaggg aggcattcaa caatctagac agtaccactt
3721 cactaactga ggaaaatttt gggaaacctg acatttcggc aaaggatttg agaaacatta
3781 tgtatgatca cttgcctggt tttggaactg ctttccacca attagtacaa gtgatttgta
3841 aattgggaaa agatagcaat tcattggaca ttattcatgc tgagttccag gccagcctgg
3901 ctgaaggaga ctcccctcaa tgtgccctaa ttcaaattac aaaaagagtt ccaatcttcc
3961 aagatgctgc tccacctgtc atccacatcc gctctcgagg tgacattccc cgagcttgcc
4021 agaagagctt gcgtccagtc ccaccatcac ccaagattga tcgaggttgg gtatgtgttt
4081 ttcagcttca agatggtaaa acacttggac tcaaaatttg agccaatctc ttttccctcc
4141 gaaagaggca actaatagca gaggcttcaa ctgctgaact atagggtatg ttacattaat
4201 gatacacttg tgagtatcag ccctagataa tataagtcaa ttaaacaacc aagataaaat
4261 tgttcatatc ccgctagcag ctttaaagat aaatgtaata ggagctatac ctctgacagt
4321 attataatta attgttatta agtaacccaa accaaaaatg atgaagatta agaaaaacct
4381 acctcgactg agagagtgtt ttttcattaa ccttcatctt gtaaacgttg agcaaaattg
4441 ttaaaaatat gaggcgggtt atattgccta ctgctcctcc tgaatatatg gaggccatat
4501 accctgccag gtcaaattca acaattgcta ggggtggcaa cagcaataca ggcttcctga
4561 caccggagtc agtcaatgga gacactccat cgaatccact caggccaatt gctgatgaca
4621 ccatcgacca tgccagccac acaccaggca gtgtgtcatc agcattcatc ctcgaagcta
4681 tggtgaatgt catatcgggc cccaaagtgc taatgaagca aattccaatt tggcttcctc
4741 taggtgtcgc tgatcaaaag acctacagct ttgactcaac tacggccgcc atcatgcttg
4801 cttcatatac tatcacccat ttcggcaagg caaccaatcc gcttgtcaga gtcaatcggc
4861 tgggtcctgg aatcccggat caccccctca ggctcctgcg aattggaaac caggctttcc
4921 tccaggagtt cgttcttcca ccagtccaac taccccagta tttcaccttt gatttgacag
4981 cactcaaact gatcactcaa ccactgcctg ctgcaacatg gaccgatgac actccaactg
5041 gatcaaatgg agcgttgcgt ccaggaattt catttcatcc aaaacttcgc cccattcttt
5101 tacccaacaa aagtgggaag aaggggaaca gtgccgatct aacatctccg gagaaaatcc
5161 aagcaataat gacttcactc caggacttta agatcgttcc aattgatcca accaaaaata
5221 tcatgggtat cgaagtgcca gaaactctgg tccacaagct gaccggtaag aaggtgactt
5281 ccaaaaatgg acaaccaatc atccctgttc ttttgccaaa gtacattggg ttggacccgg
5341 tggctccagg agacctcacc atggtaatca cacaggattg tgacacgtgt cattctcctg
5401 caagtcttcc agctgtggtt gagaagtaat tgcaataatt gactcagatc cagttttaca
5461 gaatcttctc agggatagtg ataacatctt tttaataatc cgtctactag aagagatact
5521 tctaattgat caatatacta aaggtgcttt acaccattgt ctcttttctc tcctaaatgt
5581 agagcttaac aaaagactca taatatacct gtttttaaaa gattgattga tgaaagatca
5641 tgactaataa cattacaaac aatcctacta taatcaatac ggtgattcaa atgtcaatct
5701 ttctcattgc acatactctt tgtccttatc ctcaaattgc ctacatgctt acatctgagg
5761 acagccagtg tgacttggat tggagatgtg gaggaaaaat cggggcccat ttctaagttg
5821 ttcacaatct aagtacagac attgctcttc taattaagaa aaaatcggcg atgaagatta
5881 agccgacagt gagcgtaatc ttcatctctc ttagattatt tgtcttccag agtaggggtc
5941 atcaggtcct tttcaattgg ataaccaaaa taagcttcac tagaaggata ttgtgaggcg
6001 acaacacaat gggtgttaca ggaatattgc agttacctcg tgatcgattc aagaggacat
6061 cattctttct ttgggtaatt atccttttcc aaagaacatt ttccatcccg cttggagtta
6121 tccacaatag tacattacag gttagtgatg tcgacaaact agtttgtcgt gacaaactgt
6181 catccacaaa tcaattgaga tcagttggac tgaatctcga ggggaatgga gtggcaactg
6241 acgtgccatc tgtgactaaa agatggggct tcaggtccgg tgtcccacca aaggtggtca
6301 attatgaagc tggtgaatgg gctgaaaact gctacaatct tgaaatcaaa aaacctgacg
6361 ggagtgagtg tctaccagca gcgccagacg ggattcgggg cttcccccgg tgccggtatg
6421 tgcacaaagt atcaggaacg ggaccatgtg ccggagactt tgccttccac aaagagggtg
6481 ctttcttcct gtatgatcga cttgcttcca cagttatcta ccgaggaacg actttcgctg
6541 aaggtgtcgt tgcatttctg atactgcccc aagctaagaa ggacttcttc agctcacacc
6601 ccttgagaga gccggtcaat gcaacggagg acccgtcgag tggctattat tctaccacaa
6661 ttagatatca ggctaccggt tttggaacta atgagacaga gtacttgttc gaggttgaca
6721 atttgaccta cgtccaactt gaatcaagat tcacaccaca gtttctgctc cagctgaatg
6781 agacaatata tgcaagtggg aagaggagca acaccacggg aaaactaatt tggaaggtca
6841 accccgaaat tgatacaaca atcggggagt gggccttctg ggaaactaaa aaaacctcac
6901 tagaaaaatt cgcagtgaag agttgtcttt cacagctgta tcaaacggac ccaaaaacat
6961 cagtggtcag agtccggcgc gaacttcttc cgacccagag accaacacaa caaatgaaga
7021 ccacaaaatc atggcttcag aaaattcctc tgcaatggtt caagtgcaca gtcaaggaag
7081 gaaagctgca gtgtcgcatc tgacaaccct tgccacaatc tccacgagtc ctcaacctcc
7141 cacaaccaaa acaggtccgg acaacagcac ccataataca cccgtgtata aacttgacat
7201 ctctgaggca actcaagttg gacaacatca ccgtagagca gacaacgaca gcacagcctc
7261 cgacactccc cccgccacga ccgcagccgg acccttaaaa gcagagaaca ccaacacgag
7321 taagagcgct gactccctgg acctcgccac cacgacaagc ccccaaaact acagcgagac
7381 tgctggcaac aacaacactc atcaccaaga taccggagaa gagagtgcca gcagcgggaa
7441 gctaggctta attaccaata ctattgctgg agtagcagga ctgatcacag gcgggagaag
7501 gactcgaaga gaagtaattg tcaatgctca acccaaatgc aaccccaatt tacattactg
7561 gactactcag gatgaaggtg ctgcaatcgg attggcctgg ataccatatt tcgggccagc
7621 agccgaagga atttacacag aggggctaat gcacaaccaa gatggtttaa tctgtgggtt
7681 gaggcagctg gccaacgaaa cgactcaagc tctccaactg ttcctgagag ccacaactga
7741 gctgcgaacc ttttcaatcc tcaaccgtaa ggcaattgac ttcctgctgc agcgatgggg
7801 tggcacatgc cacattttgg gaccggactg ctgtatcgaa ccacatgatt ggaccaagaa
7861 cataacagac aaaattgatc agattattca tgattttgtt gataaaaccc ttccggacca
7921 gggggacaat gacaattggt ggacaggatg gagacaatgg ataccggcag gtattggagt
7981 tacaggtgtt ataattgcag ttatcgcttt attctgtata tgcaaatttg tcttttagtc
8041 tttcttcaga ttgtttcacg gcaaaactca acctcaaatc aatgaaacta ggatttaatt
8101 atatgaatca cttgaatcta agattacttg acaaatgata acataataca ctggagcttc
8161 aaacatagcc aatgtgattc taactccttt aaactcacag ttaatcataa acaaggtttg
8221 acatcaatct agctatatct ttaagaatga taaacttgat gaagattaag aaaaaggtaa
8281 tctttcgatt atctttagtc ttcatccttg attctacaat catgacagtt gtctttaatg
8341 aaaaaggaaa aaagcctttt tattaagttg taataatcag atctgcaaac cggtagaatt
8401 tagttgtaac ctaacacaca caaagcattg gtaaaaaagt caatagaaat ttaaacagtg
8461 agtgcagaca actcttaaat ggaagcttca tatgagagag gacgcccccg agctgccaga
8521 cagcattcaa gggatggaca cgaccaccat gttcgagcac gatcatcatc cagagagaat
8581 tatcgaggtg agtaccgtca atcaaggagc gcctcacaag tgcgcgttcc tactgtattt
8641 cataagaaga gagttgaacc attaacagtt cctccagcac ctaaagacat atgtccgacc
8701 ttgaaaaaag gatttttgtg tgacagtagt ttttgcaaaa aagaccacca gttagaaagt
8761 ttaactgata gggaattact cctactaatc gcccgtaaga cttgtggatc agtagaacaa
8821 caattaaata taactgcacc caaggactcg cgcttagcaa atccaacggc tgatgatttc
8881 cagcaagagg aaggtccaaa aattaccttg ttgacactga tcaagacggc agaacactgg
8941 gcgagacaag acatccgaac catagaggat tccaaattaa gggcattgtt aactctatgt
9001 gctgtgatga cgaggaaatt ctcaaaatcc cagctgagtc ttttgtgtga gacacaccta
9061 aggcgcgaag ggcttgggca agatcaggca gaacccgttc tcgaagtata tcaacgatta
9121 cacagtgata aaggaggcag ttttgaagct gcactatggc aacaatggga ccgacaatcc
9181 ctaattatgt ttatcactgc attcttgaat atcgctctcc agttaccgtg tgaaagttct
9241 gctgtcgttg tttcagggtt aagaacattg gttcctcaat cagataatga ggaagcttca
9301 accaacccgg ggacatgctc atggtctgat gagggtaccc cttaataagg ctgactaaaa
9361 cactatataa ccttctactt gatcacaata ctccgtatac ctatcatcat atatttaatc
9421 aagacgatat cctttaaaac ttattcagta ctataatcac tctcatttca aattgataag
9481 atatgcataa ttgccttaat atataaagag gtatgatata acccaaacat tgaccaaaga
9541 aaatcataat ctcgtatcgc tcgcaatata acctgccaag catacctctt gcacaaagtg
9601 attcttgtac acaaataatg tttgactcta caggaggtag caacgatcca tctcatcaaa
9661 aaataagtat tttatgattt actaatgatc tcttaaaata ttaagaaaaa ctgacggaac
9721 ataaattctt tctgcttcaa gttgtggagg aggtctatgg tattcgctat tgttatatta
9781 caatcaataa caagcttgta aaaatattgt tcttgtttca ggaggtatat tgtgaccgga
9841 aaagctaaac taatgatgaa gattaatgcg gaggtctgat gagaataaac cttattattc
9901 agattaggcc ccaagaggca ttcttcatct ccttttagca aaatactatt tcaggatagt
9961 ccagctagtg acacgtcttt tagctgtata ccagttgccc ctgagatacg ccacaaaagt
10021 gtctctgagc taaagtggtc tgtacacatc tcatacattg tattaggggc aataatatct
10081 aattgaactt agccatttaa aatttagtgc ataaatctgg gctaactcca ccaggtcaac
10141 tccattggct gaaaagaagc ccacctacaa cgaacattac tttgagcgcc ctcacaatta
10201 aaaaataaga gcgtcgttcc aacaatcgag cgcaaggtta caaggttgaa ctgagagtgt
10261 ctagacaaca aaatatcgat actccagaca ccaagcaaga cctgagaaaa aaccatggcc
10321 aaagctacgg gacgatacaa tctaatatcg cccaaaaagg acctggagaa aggggttgtc
10381 ttaagcgacc tctgtaactt cttagttagt caaactattc aagggtggaa agtttattgg
10441 gctggtattg agtttgatgt gactcacaaa ggaatggccc tattgcatag actgaaaact
10501 aatgactttg cccctgcatg gtcaatgaca aggaacctat ttccccattt atttcaaaat
10561 ccgaattcca ctattgaatc accgctgtgg gcactgagag tcatccttgc agcagggata
10621 caggaccagt taattgacca gtctttgatt gaacccttag caggagccct tggtctgatc
10681 tctgattggc tgctaacaac caacactaac catttcaaca tgcgaacaca acgtgtcaag
10741 gaacaattga gcctaaaaat gctgtcgttg attcgatcca atattctcaa gtttattaac
10801 aaattggatg ctctacatgt cgtgaactac aatggattat tgagcagtat tgaaattgga
10861 actcaaaatc atacaatcat cataactcga actaacatgg gttttctggt ggagctccaa
10921 gaacccgaca aatcggcaat gaaccgcaag aagcctgggc cggcgaaatt ttccctcctt
10981 catgagtcca cactgaaagc atttacacaa gggtcctcga cacgaatgca aagtttaatt
11041 cttgaattca atagctctct tgctatctaa ctaagatgga atacttcata ttgggctaac
11101 tcatatatgc tgactcaata gttaacttga catctctgcc ttcataatca gatatataag
11161 cataataaat aaatactcat atttcttgat aatttgttta accacagata aatcctcact
11221 gtaagccagc ttccaagttg acacccttac aaaaaccagg actcagaatc cctcaaataa
11281 gagattccaa gacaacatca tagaattgct ttattatatt aataagcatt ttatcactag
11341 aaatccaata tacgaaatgg ttaattgtaa ctaaacccgc aggtcatgtg tgttaggttt
11401 cacaaattat atatattact aactccatac tcgtaactaa cattagataa gtaggttaag
11461 aaaaaagctt gaggaagatt aagaaaaact gcttattggg tctttccgtg ttttagatga
11521 agcagttgac attcttcctc ttgatattaa atggctacac aacataccca atacccagac
11581 gccaggttat catcaccaat tgtattggac caatgtgacc ttgtcactag agcttgcggg
11641 ttgtattcat catactccct taatccgcaa ctacgcaact gtaaactccc gaaacatata
11701 taccgtttaa aatatgatgt aactgttacc aagttcttaa gtgatgtacc agtggcgaca
11761 ttgcccatag atttcatagt cccaattctt ctcaaggcac tatcaggcaa tgggttctgt
11821 cctgttgagc cgcggtgcca acagttctta gatgaaatta ttaagtacac aatgcaagat
11881 gctctcttcc tgaaatatta tctcaaaaat gtgggtgctc aagaagactg tgttgatgac
11941 cactttcaag aaaaaatctt atcttcaatt cagggcaatg aatttttaca tcaaatgttt
12001 ttctggtatg acctggctat tttaactcga aggggtagat taaatcgagg aaactctaga
12061 tcaacgtggt ttgttcatga tgatttaata gacatcttag gctatgggga ctatgttttt
12121 tggaagatcc caatttcact gttaccactg aacacacaag gaatccccca tgctgctatg
12181 gattggtatc agacatcagt attcaaagaa gcggttcaag ggcatacaca cattgtttct
12241 gtttctactg ccgatgtctt gataatgtgc aaagatttaa ttacatgtcg attcaacaca
12301 actctaatct caaaaatagc agaggttgag gacccagttt gctctgatta tcccaatttt
12361 aagattgtgt ctatgcttta ccagagcgga gattacttac tctccatatt agggtctgat
12421 gggtataaaa tcattaagtt tctcgaacca ttgtgcttgg ctaaaattca attgtgctca
12481 aagtacaccg agaggaaggg ccgattctta acacaaatgc atttagctgt aaatcacacc
12541 ctggaagaaa ttacagaaat acgtgcacta aagccttcac aggctcacaa gatccgtgaa
12601 ttccatagaa cattgataag gctggagatg acgccacaac aactttgtga gctattttcc
12661 atacaaaaac actgggggca tcctgtgcta catagtgaaa cagcaatcca aaaagttaaa
12721 aaacatgcta cggtgctaaa agcattacgc cctatcgtga ttttcgagac atattgtgtt
12781 tttaaatata gcattgcaaa acattatttt gatagtcaag gatcttggta cagtgttacc
12841 tcagatagaa atctaacacc aggtcttaat tcttatatca aaagaaatca attccctccg
12901 ttgccaatga ttaaagaact gctatgggaa ttttaccacc ttgaccatcc tccacttttc
12961 tcaaccaaaa ttattagtga cttaagtatt tttataaaag acagagctac tgcagtagaa
13021 aggacatgct gggatgcagt attcgagcct aatgttctgg gatataatcc acctcacaaa
13081 ttcagtacca aacgtgtacc ggaacaattt ttagagcaag aaaacttttc tattgagaat
13141 gttctttcct acgcgcaaaa actcgagtat ctactaccac aatatcggaa tttttctttc
13201 tcattgaaag agaaagagtt gaatgtaggt agaactttcg gaaaattgcc ttatccgact
13261 cgcaatgttc aaacactttg tgaagctctg ttagctgatg gtcttgctaa agcatttcct
13321 agcaatatga tggtagttac ggaacgtgaa caaaaagaaa gcttattgca tcaagcatca
13381 tggcaccaca caagtgatga tttcggtgag catgccacag ttagagggag tagctttgta
13441 actgatttag agaaatacaa tcttgcattt aggtatgagt ttacagcacc ttttatagaa
13501 tattgcaacc gttgctatgg tgttaagaat gtttttaatt ggatgcatta tacaatccca
13561 cagtgttata tgcatgtcag tgattattat aatccaccgc ataacctcac actggaaaat
13621 cgaaacaacc cccctgaagg gcctagttca tacaggggtc atatgggagg gattgaagga
13681 ctgcaacaaa aactctggac aagtatttca tgtgctcaaa tttctttagt tgaaattaag
13741 actggtttta agttgcgctc agctgtgatg ggtgacaatc agtgcattac cgttttatca
13801 gtcttcccct tagagactga tgcaggcgag caggaacaga gcgccgagga caatgcagcg
13861 agggtggccg ccagcctagc aaaagttaca agtgcctgtg gaatcttttt aaaacctgat
13921 gaaacatttg tacattcagg ttttatctat tttggaaaaa aacaatattt gaatggggtc
13981 caattgcctc agtcccttaa aacggctaca agaatggcac cattgtctga tgcaattttt
14041 gatgatcttc aagggaccct ggctagtata ggtactgctt ttgagcgatc catctctgag
14101 acacgacata tctttccttg cagaataacc gcagctttcc atacgttctt ttcggtgaga
14161 atcttgcaat atcatcacct cggatttaat aaaggttttg accttggaca gttaacactc
14221 ggcaaacctc tggatttcgg aacaatatca ttggcactag cggtaccgca ggtgcttgga
14281 gggttatcct tcttgaatcc tgagaaatgt ttctaccgga atctaggaga tccagttacc
14341 tcaggtttat tccagttaaa aacttatctc cgaatgattg agatggatga tttattctta
14401 cctttaattg cgaagaaccc tgggaactgc actgccattg actttgtgct aaatcctagc
14461 ggattaaatg ttcctgggtc gcaagactta acttcatttc tgcgccagat tgtacgtagg
14521 actatcaccc taagtgcgaa aaacaaactt attaatacct tatttcatgc atcagctgac
14581 ttcgaagacg aaatggtttg taagtggctc ttatcatcaa ctcctgttat gagtcgtttc
14641 gcagccgata tattttcacg cacgccgagc gggaagcgat tgcaaattct aggatacttg
14701 gaaggaacac gcacattatt agcctctaag atcatcaaca ataatacaga gacgccggtt
14761 ttggacagac tgaggaagat aacattgcaa aggtggagtc tatggtttag ttatcttgat
14821 cattgtgata atatcctggc ggaggcttta acccaaataa cttgcacagt tgatttagca
14881 cagatcctga gggaatattc atgggcacat attttagagg ggagacctct tattggagcc
14941 acactcccat gtatgattga gcaattcaaa gtggtttggc tgaaacccta cgaacaatgt
15001 ccgcagtgtt caaatgccaa gcaacctggt gggaaaccat tcgtgtcagt agcagtcaag
15061 aaacatattg ttagtgcatg gccaaatgca tcccgaataa gctggactat cggggatgga
15121 atcccataca ttggatcaag gacagaagat aagatagggc aacctgctat taaaccaaaa
15181 tgtccttccg cagccttaag agaggccatt gaattggcgt cccgtttaac atgggtaact
15241 caaggcagtt cgaacagtga cttgctaata aaaccatttt tggaagcacg agtaaattta
15301 agtgttcaag aaatacttca aatgacccct tcacattact cgggaaatat tgttcatagg
15361 tacaacgatc aatacagtcc tcattctttc atggccaatc gtatgagtaa ctcagcaacg
15421 cgattgattg tttctacaaa cactttaggt gagttttcag gaggtggcca atcggcacgc
15481 gacagcaata ttattttcca gaatgttata aattatgcag ttgcactgtt cgatattaaa
15541 tttagaaaca ctgaggctac agatatccag tataatcgtg ctcaccttca tctaactaag
15601 tgttgcaccc gggaggtacc agctcagtac ttaacataca catctacatt ggatttagat
15661 ttaacaagat accgagaaaa tgaattgatt tatgacaata atcctctaaa aggaggactc
15721 aattgcaata tctcatttga taacccattt ttccaaggca aacagctgaa cattatagaa
15781 gatgacctta ttcgactgcc tcacttatct ggatgggagc tagctaagac catcatgcaa
15841 tcaattattt cagatagcaa taattcgtct acagacccaa ttagcagtgg agaaacaaga
15901 tcattcacta cccatttctt aacttatccc aagataggac ttctgtacag ttttggggcc
15961 tttgtaagtt attatcttgg caatacaatt cttcggacta agaaattaac acttgacaat
16021 tttttatatt acttaactac ccaaattcat aatctaccac atcgctcatt gcgaatactt
16081 aagccaacat tcaaacatgc aagcgttatg tcacgattaa tgagtattga tccccatttt
16141 tctatttaca taggcggtgc tgcaggtgac agaggactct cagatgcggc caggttattt
16201 ttgagaacgt ccatttcatc ttttcttaca tttgtaaagg aatggataat taatcgcgga
16261 acaattgtcc ctttatggat agtatatcca ttagagggtc aaaatccaac acctgttaat
16321 aatttcctcc atcagatcgt agaactgctg gtgcatgatt catcaagaca ccaggctttt
16381 aaaactacca taaatgatca tgtacatcct cacgacaatc ttgtttacac atgtaagagt
16441 acagccagca atttcttcca tgcgtcattg gcgtactgga ggagcaggca cagaaacagc
16501 aaccgaaaag acttgacaag aaactcttca actggatcaa gcacaaacaa cagtgatggt
16561 catattaaga gaagtcaaga acaaaccacc agagatccac atgatggcac tgaacggagt
16621 ctagtcctgc aaatgagcca tgaaataaaa agaacgacaa ttccacaaga gaacacgcac
16681 cagggtccgt cgttccagtc atttctaagt gactctgctt gcggtacagc aaacccaaaa
16741 ctaaatttcg atagatcgag acacaatgtg aaatctcagg atcataactc agcatccaag
16801 agggaaggtc atcaaataat ctcacatcgt ctagtcctac ctttctttac attatctcaa
16861 gggacacgcc aattaacgtc atccaatgag tcacaaaccc aagatgagat atcaaagtac
16921 ttacggcaat tgagatccgt cattgatacc acagtttatt gtaggtttac cggtatagtc
16981 tcgtccatgc attacaaact tgatgaggtc ctttgggaaa tagagaattt taagtcggct
17041 gtgacgctgg cagagggaga aggtgctggt gccttactat tgattcagaa ataccaagtt
17101 aagaccttat ttttcaacac gctagctact gagtccagta tagagtcaga aatagtatca
17161 ggaatgacta ctcctaggat gcttctacct gttatgtcaa aattccataa tgaccaaatt
17221 gagattattc ttaacaactc agcaagccaa ataacagaca taacaaatcc tacttggttt
17281 aaagaccaaa gagcaaggct acctaggcaa gtcgaggtta taaccatgga tgcagagacg
17341 acagagaata taaacagatc gaaattgtac gaagctgtac ataaattgat cttacaccat
17401 gttgatccca gcgtattgaa agcagtggtc cttaaagtct ttctaagtga taccgagggt
17461 atgttatggc taaatgataa tctagccccg ttttttgcca ctgggtattt aattaagcca
17521 ataacgtcaa gtgccaggtc tagtgagtgg tatctttgtc tgacgaactt cttatcaact
17581 acacgtaaga tgccacacca aaaccatctc agttgtaagc aggtaatact tacggcattg
17641 caactgcaaa ttcaacggag cccatactgg ctaagtcatt taactcagta tgctgactgc
17701 gatttacatt taagctatat ccgccttggt tttccatcat tagagaaagt actataccac
17761 aggtataacc ttgtcgattc aaaaagaggt ccactagtct ctgtcactca gcacttagca
17821 catcttaggg cagagattcg agaattgacc aatgattata atcaacagcg acaaagtcgg
17881 actcaaacat atcactttat tcgtactgca aaaggacgaa tcacaaaact agtcaatgat
17941 tatttaaaat tctttcttat tgtacaagca ttaaaacata atgggacatg gcaagctgag
18001 tttaagaaat taccagagtt gattagtgtg tgcaataggt tctatcatat tagagattgt
18061 aattgtgaag aacgtttctt agttcaaacc ttatatttac atagaatgca ggattctgaa
18121 gttaagctta tcgaaaggct gacagggctt ctgagtttat ttccagatgg tctctacagg
18181 ttcgattgaa taaccgtgca tagtattttg atacttgtaa aggttggtta tcaacataca
18241 gattataaaa aactcataaa ttgctctcat acatcatctt gatctgattt caataaataa
18301 ctatttagat aacgaaagga gtccttacat tatacactat atttggcctc tctccctgcg
18361 tgataatcaa aaaattcaca atacagcatg tgtgacatat tactgctgca atgagtctaa
18421 cgcaacataa taaactccgc actctttata attaagcttt aacgataggt ctgggctcat
18481 attgttattg atatagtaat gttgtatcaa tatcttgcca gatggaatag tgctttggtt
18541 gataacacga cttcttaaaa caaaactgat ctttaagatt aagtttttta taattgtcat
18601 tgctttaatt tgtcgattta aaaatggtga tagccttaat ctttgtgtaa aataagagat
18661 taggtgtaat aactttaaca tttttgtcta gtaagctact attccattca gaatgataaa
18721 attaaaagaa aagacatgac tgtaaaatca gaaatacctt ctttacaata tagcagacta
18781 gataataatc ttcgtgttaa tgataattaa ggcattgacc acgctcatca gaaggctcac
18841 tagaataaac gttgcaaaaa ggatccctgg aaaaatggtc gcacacaaaa atttaaaaat
18901 aaatctattt cttctttttt gtgtgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 113 posts ]  Go to page 1, 2, 3, 4, 5 ... 12  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 106 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group