Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 3:37 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 5 posts ] 
Author Message
PostPosted: Fri Jun 20, 2014 9:18 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
USDA has released May 2014 Indiana swine sequences that match 2012 H3N2v cases.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jun 20, 2014 9:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KJ859588 1701 bp cRNA linear VRL 15-JUN-2014
DEFINITION Influenza A virus (A/swine/Indiana/A01410773/2014(H3N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KJ859588
VERSION KJ859588.1 GI:649782676
KEYWORDS .
SOURCE Influenza A virus (A/swine/Indiana/A01410773/2014(H3N2))
ORGANISM Influenza A virus (A/swine/Indiana/A01410773/2014(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Deike,P.H. and Zhang,J.
CONSRTM USDA Swine Influenza Surveillance
TITLE Direct Submission
JOURNAL Submitted (21-MAY-2014) National Veterinary Services Labortary,
USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Indiana/A01410773/2014(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Indiana/A01410773/2014"
/serotype="H3N2"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1502003"
/segment="4"
/country="USA: Indiana"
/collection_date="May-2014"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIC64845.1"
/db_xref="GI:649782677"
/translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVQSSSTGRICNSPHQVLDGKNCTLIDALLGDPHCDDFQNKEWDL
FVERSTAYSNCYPYYVPDYATLRSLVASSGNLEFTQESFNWTGVAQDGSSYACRRGSV
KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
IVSTKRSQQTVIPNIGSKPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
QSGKSSIMRSDAHIDKCNSECITPNGSISNDKPFQNVNKITYGACPRYIKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
ITGKLDRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
NEALNNRFQIKGVQLKSGYKEWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:IRD-A01410773.4"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatt ctatgtctga ttttcgctca aaaacttccc
61 ggaagtgaca acagcatggc aacgctgtgc ctgggacacc atgcagtgcc aaacggaaca
121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
181 agttcctcaa caggtagaat atgcaacagt cctcaccaag tccttgatgg gaaaaattgc
241 acactgatag atgctctatt gggggaccct cattgtgatg actttcaaaa caaggaatgg
301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
361 tatgccaccc ttaggtcact agttgcttca tctggcaacc tggaattcac ccaagaaagc
421 ttcaattgga ctggagttgc tcaagacgga tcaagctatg cctgcagaag gggatctgtt
481 aaaagtttct ttagtagatt gaattggttg tataacttga attacaagta tccagaacag
541 aacgtaacca tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
601 ccgggtacgg acaaggacca aaccaaccta tatgtccaag catcagggag agttatagtc
661 tctaccaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctaaacc ctgggtaagg
721 ggtgtctcca gcataataag catctattgg acgatagtaa aaccgggaga catacttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
841 agctcaataa tgagatcaga tgcacacatt gataaatgca attctgaatg cattactcca
901 aatggaagca tttccaatga caaacctttt caaaatgtaa ataagatcac atatggagcc
961 tgtcccagat atattaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
1021 gagaaacaaa ctagaggcat attcggcgca atagcaggtt tcatagaaaa tggttgggaa
1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
1141 gcagatctta aaagcactca agcagcaatc aaccaaatca ccgggaaact agatagagta
1201 atcaagaaaa cgaacgagaa attccatcaa attgaaaaag aattctcaga agtagaaggg
1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catgggcaat
1441 ggttgcttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaatgga
1501 acctatgacc atgacatata tagaaacgag gcattaaaca atcggttcca gatcaaaggt
1561 gttcagctaa agtcaggata caaagaatgg atcctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgttct gctggggttc attatgtggg cctgccaaaa aggcaacatt
1681 aggtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jun 20, 2014 9:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI499654 A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI510220 A/swine/North Carolina/A01409981/2014 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1694/1701 (99%)
EPI531044 A/swine/North Carolina/A01475277/2014 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI398124 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI398672 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI391413 A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI493012 A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI396270 A/Indiana/133/2012 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI394913 A/Indiana/132/2012 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI388327 A/Indiana/14/2012 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI528431 A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI527870 A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI527113 A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI433540 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI433533 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI433306 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI433298 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI408199 A/swine/Indiana/A01260093/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI401684 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI401680 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI398500 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395956 A/swine/Indiana/A00968379/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395948 A/swine/Indiana/A00968376/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395940 A/swine/Indiana/A00968373/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395932 A/swine/Indiana/A00968370/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395740 A/swine/Indiana/A00968386/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395267 A/Ohio/65/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393695 A/West Virginia/16/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393681 A/West Virginia/10/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393673 A/Ohio/71/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393317 A/Ohio/38/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393311 A/West Virginia/09/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI391404 A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI383528 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI378523 A/Indiana/09/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI378515 A/Indiana/07/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI378502 A/Indiana/07/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI366030 A/Utah/10/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI346493 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1680/1701 (98%)
EPI395328 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1680/1701 (98%)
EPI492349 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446919 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446863 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446830 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI443558 A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI443526 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI426890 A/swine/Indiana/A01432300/2013 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI424073 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI414178 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI406530 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401702 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401667 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI400105 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI400101 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398542 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398534 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398526 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398518 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398479 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jun 20, 2014 9:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI499655 A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI510221 A/swine/North Carolina/A01409981/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI398123 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI509736 A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI492350 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI404892 A/Iowa/16/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI400102 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397395 A/Indiana/93/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397377 A/Indiana/123/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397363 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI396269 A/Indiana/133/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395958 A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395950 A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395934 A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395921 A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395885 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395860 A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395852 A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395742 A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395330 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395327 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394936 A/Ohio/75/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394932 A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394920 A/Ohio/69/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394912 A/Indiana/132/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394905 A/Ohio/62/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI393696 A/Indiana/20/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI393687 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jun 20, 2014 9:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI531046 A/swine/North Carolina/A01475277/2014 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI510222 A/swine/North Carolina/A01409981/2014 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI499656 A/swine/North Carolina/A01409048/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI492430 A/swine/North Carolina/A01290458/2013 (A/H1N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI492403 A/swine/North Carolina/A01290462/2013 (A/H1N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI476512 A/swine/North Carolina/A01290349/2013 (A/H1N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI467465 A/swine/North Carolina/A01432952/2013 (A/H1N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI451188 A/swine/North Carolina/A01432634/2013 (A/H1N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI502715 A/swine/North Carolina/A01290800/2013 (A/H1N2) segment 7 (MP) 1805.3 0.000000e+00 980/982 (99%)
EPI531079 A/swine/North Carolina/A01410533/2014 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI531007 A/swine/North Carolina/A01475257/2014 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI531001 A/swine/North Carolina/A01475256/2014 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI530317 A/swine/North Carolina/A01410329/2014 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI502700 A/swine/North Carolina/A01290857/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI502651 A/swine/North Carolina/A01290856/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI499665 A/swine/North Carolina/A01290725/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI492427 A/swine/North Carolina/A01290473/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI492393 A/swine/North Carolina/A01290447/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI489709 A/swine/South Carolina/A01394262/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI487968 A/swine/North Carolina/A01291004/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI487213 A/swine/North Carolina/A01290534/2013 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI531049 A/swine/North Carolina/A01410511/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509545 A/swine/North Carolina/A01410024/2013 (A/H0) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509540 A/swine/North Carolina/A01290805/2013 (A/H0) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI509529 A/swine/North Carolina/A01290797/2013 (A/H0) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI508851 A/swine/North Carolina/A01410136/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI507277 A/swine/North Carolina/A01409655/2014 (A/H1N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI499637 A/swine/North Carolina/A01290636/2013 (A/H1N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI459659 A/swine/Pennsylvania/A01380412/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI531067 A/swine/North Carolina/A01410520/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI531058 A/swine/North Carolina/A01410535/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI531052 A/swine/North Carolina/A01410554/2014 (A/H0) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI531010 A/swine/North Carolina/A01410555/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI510231 A/swine/North Carolina/A01409950/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI510180 A/swine/North Carolina/A01410205/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI508877 A/swine/North Carolina/A01410180/2014 (A/H3N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI505101 A/swine/North Carolina/A01290956/2013 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI504902 A/swine/Illinois/A01411204/2013 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI499985 A/swine/North Carolina/A01394918/2013 (A/H1N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI499701 A/swine/North Carolina/A01290729/2013 (A/H1N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI487964 A/swine/North Carolina/A01290565/2013 (A/H0) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI463707 A/swine/North Carolina/A01432766/2013 (A/H1N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI531073 A/swine/North Carolina/A01475272/2014 (A/H1N1) segment 7 (MP) 1788.7 0.000000e+00 977/982 (99%)
EPI531013 A/swine/North Carolina/A01475255/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI530295 A/swine/North Carolina/A01410422/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI502663 A/swine/Illinois/A01290887/2013 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI492963 A/swine/Minnesota/A01394248/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI492380 A/swine/Minnesota/A01392079/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI489727 A/swine/Minnesota/A01394021/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI441498 A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI433271 A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI426874 A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414110 A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414104 A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414053 A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414050 A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414038 A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI408198 A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI407026 A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI406535 A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI398690 A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI395329 A/West Virginia/06/2011 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI395324 A/West Virginia/06/2011 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI391475 A/swine/Ohio/A01203186/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI391470 A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI492409 A/swine/North Carolina/A01290442/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI492351 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI487944 A/swine/Minnesota/A01394278/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI485857 A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI464431 A/swine/Ohio/A01351184/2013 (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI451230 A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI449017 A/swine/Wyoming/A01379346/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446881 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446873 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446857 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446832 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446824 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI446733 A/swine/Ohio/A01349572/2013 (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI433321 A/swine/Wyoming/A01444560/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI427146 A/swine/Maryland/A01444460/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI427131 A/swine/Wyoming/A01444562/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI414181 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI407274 A/Minnesota/18/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI406513 A/swine/Iowa/A01432069/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI401715 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI401659 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI401625 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI401615 A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI399378 A/swine/North Carolina/A01300819/2012 (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI398545 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI398537 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI398122 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397957 A/Ohio/88/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397943 A/Ohio/84/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397902 A/Hawaii/03/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397551 A/Ohio/86/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397535 A/Ohio/56/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397435 A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI397421 A/Minnesota/15/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI396197 A/Ohio/79/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 5 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Majestic-12 [Bot], Yahoo [Bot] and 64 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group