Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Sep 20, 2017 1:42 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Tue Jul 23, 2013 7:35 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Recent human H3N2v sequences from outbreaks in Indiana had either N145K (primarily linked to the Grant County Fair) or N145R (primarily linked to the Hancock County Fair). These polymorphisms were not seen in recent H3N2v human or swine sequences.

Today the USDA released H3, N2, MP sequences from a June 2013 isolate from Illinois. A/swine/Illinois/A01432795/2013, which has N145K and is closely related to the human sequences from Indiana.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jul 23, 2013 7:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KF282745 1701 bp cRNA linear VRL 21-JUL-2013
DEFINITION Influenza A virus (A/swine/Illinois/A01432795/2013(H3N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KF282745
VERSION KF282745.1 GI:523793857
KEYWORDS .
SOURCE Influenza A virus (A/swine/Illinois/A01432795/2013(H3N2))
ORGANISM Influenza A virus (A/swine/Illinois/A01432795/2013(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
CONSRTM USDA Swine Influenza Surveillance
TITLE Direct Submission
JOURNAL Submitted (24-JUN-2013) USDA Swine Influenza Surveillance, National
Veterinary Services Laboratories, 1600 South 16th Street, Ames, IA
50011, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Illinois/A01432795/2013(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Illinois/A01432795/2013"
/serotype="H3N2"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1349393"
/segment="4"
/country="USA: Illinois"
/collection_date="Jun-2013"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AGQ88464.1"
/db_xref="GI:523793858"
/translation="MKTIIAFSCILCLIFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDL
FVERSTAYSNCYPYYVPDYATLRSLVASSGNLEFTQESFNWTGVAQDGSSYACRRGSV
KSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRV
IVSTKRSQQTVIPNIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
QSGKSSIMRSDAHIDECNSECITPNGSISNDKPFQNVNKITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:IRD-A01432795.4"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatt ctatgtctga ttttcgctca aaaacttccc
61 ggaagtgaca acagcatggc aacgctgtgc ctgggacacc atgcagtgcc aaacggaaca
121 ttagtgaaaa caatcacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
241 acactgatag atgctctatt gggggaccct cattgtgatg acttccaaaa caaggaatgg
301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
361 tatgctaccc ttaggtcact agttgcctca tctggcaacc tggaatttac ccaagaaagc
421 ttcaattgga ctggagttgc tcaagacgga tcaagctatg cctgcagaag gggatctgtt
481 aaaagtttct ttagtagatt gaattggttg tataacttga attacaagta tccagaacag
541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
601 ccgggtacgg acaaggacca aaccaaccta tatgtccaag catcagggag agttatagtc
661 tctaccaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctagacc ctgggtaagg
721 ggtgtatcca gcataataag catctattgg acgatagtaa aaccgggaga catacttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
841 agctcaataa tgagatcaga tgcacacatt gatgaatgca attctgaatg cattactcca
901 aatggaagca tttccaatga caaacctttt caaaatgtaa acaagattac atatggagcc
961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaacgtacca
1021 gagaaacaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
1081 ggaatggtag acggttggta cggtttcagg catcagaatt ctgaaggcac aggacaagca
1141 gcagatctta agagcactca agcagcaatc aaccaaatca ccgggaaact aaatagagta
1201 atcaagaaaa cgaacgagaa attccatcaa atcgaaaaag aattctcaga agtagaaggg
1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
1381 aacaaactgt tcgaaagaac aagaaggcaa ttgcgggaaa atgctgagga catgggcaat
1441 ggttgtttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaatgga
1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaggt
1561 gttcagctaa aatcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgttct gctggggttc attatgtggg cctgccaaaa aggcaacatt
1681 aggtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jul 23, 2013 8:01 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI462227 A/Indiana/15/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI461883 A/Indiana/09/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI462224 A/Indiana/18/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461877 A/Indiana/08/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI460760 A/Indiana/07/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461874 A/Indiana/06/2013 (A/H3N2) segment 4 (HA) 3114.6 0.000000e+00 1696/1701 (99%)
EPI462212 A/Indiana/17/2013 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1686/1689 (99%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI462215 A/Indiana/16/2013 (A/H3N2) segment 4 (HA) 3096.1 0.000000e+00 1684/1688 (99%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3094.3 0.000000e+00 1692/1701 (99%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446919 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446863 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446830 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443558 A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443526 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI440751 A/swine/Indiana/A01432492/2013 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433540 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433533 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433306 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433298 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI424073 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI414178 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI406530 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401702 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401684 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401680 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401667 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI400105 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398542 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398534 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398526 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398518 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398500 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398479 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397759 A/Wisconsin/35/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397540 A/Ohio/56/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397516 A/Ohio/36/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397503 A/Indiana/104/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397446 A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397385 A/Indiana/138/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397351 A/Ohio/37/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397340 A/Indiana/150/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397089 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396299 A/Maryland/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396280 A/Indiana/144/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396208 A/Indiana/149/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396192 A/Ohio/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396183 A/Indiana/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396175 A/Ohio/80/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395874 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395866 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395718 A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395711 A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395357 A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395344 A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395270 A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395267 A/Ohio/65/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394937 A/Ohio/75/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394933 A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394921 A/Ohio/69/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394077 A/Wisconsin/27/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jul 23, 2013 8:04 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI398123 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI404892 A/Iowa/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400102 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397395 A/Indiana/93/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397377 A/Indiana/123/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397363 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396269 A/Indiana/133/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395958 A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395950 A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395934 A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395921 A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395885 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395860 A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395852 A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395742 A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395330 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395327 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394936 A/Ohio/75/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394932 A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394920 A/Ohio/69/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394912 A/Indiana/132/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394905 A/Ohio/62/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393915 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393696 A/Indiana/20/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393687 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393666 A/Ohio/28/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393510 A/Ohio/52/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393316 A/Ohio/38/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jul 23, 2013 8:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI460975 A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI451205 A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI448836 A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI447028 A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443110 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443107 A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443100 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443097 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI441501 A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI427186 A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI426885 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI424076 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI414154 A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI406528 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI406505 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI404893 A/Iowa/16/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI451230 A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446881 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446873 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446857 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446832 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446824 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446736 A/swine/Ohio/A01349615/2013 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI414181 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI407274 A/Minnesota/18/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401715 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401659 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401615 A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI398545 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI398537 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397957 A/Ohio/88/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397943 A/Ohio/84/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397902 A/Hawaii/03/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397551 A/Ohio/86/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397535 A/Ohio/56/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397435 A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397421 A/Minnesota/15/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396197 A/Ohio/79/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396187 A/Ohio/77/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396172 A/Ohio/80/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395930 A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395877 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395869 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395354 A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395340 A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395268 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI394928 A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI393916 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI393699 A/Ohio/64/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI394067 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1807.1 0.000000e+00 980/981 (99%)
EPI394917 A/Ohio/69/2012 (A/H3N2) segment 7 (MP) 1805.3 0.000000e+00 980/982 (99%)
EPI461015 A/swine/South Dakota/A01350803/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI460762 A/Indiana/07/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 976/976 (100%)
EPI453568 A/swine/Indiana/A01260230/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI451224 A/swine/Ohio/A01208180/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI446921 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI446913 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443536 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443528 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443512 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443504 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI441498 A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI440749 A/swine/Indiana/A01432492/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433543 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433536 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433300 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433292 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433280 A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433271 A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI427192 A/swine/Indiana/A01260169/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI426905 A/swine/Iowa/A01432308/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI426874 A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414189 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414173 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414110 A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414104 A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414053 A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414050 A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414038 A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408339 A/swine/Indiana/A01432186/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408210 A/swine/Indiana/A01260110/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408204 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408198 A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI407026 A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406574 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406535 A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406471 A/swine/Indiana/A01260041/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406468 A/swine/Indiana/A01260029/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI401623 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI401619 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI400107 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI400104 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398690 A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398529 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398503 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398150 A/swine/Ohio/25/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398039 A/West Virginia/09/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398038 A/Ohio/38/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397940 A/Ohio/81/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397921 A/Ohio/18/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jul 27, 2013 5:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Update

EPI464503 A/Indiana/04/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI464500 A/Indiana/05/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI462227 A/Indiana/15/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI461883 A/Indiana/09/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI464511 A/Indiana/10/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI462224 A/Indiana/18/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461877 A/Indiana/08/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI460760 A/Indiana/07/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461874 A/Indiana/06/2013 (A/H3N2) segment 4 (HA) 3114.6 0.000000e+00 1696/1701 (99%)
EPI462212 A/Indiana/17/2013 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1686/1689 (99%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI462215 A/Indiana/16/2013 (A/H3N2) segment 4 (HA) 3096.1 0.000000e+00 1684/1688 (99%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3094.3 0.000000e+00 1692/1701 (99%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446919 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446863 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446830 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443558 A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443526 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI440751 A/swine/Indiana/A01432492/2013 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433540 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433533 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433306 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433298 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI424073 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI414178 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI406530 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401702 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401684 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401680 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401667 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI400105 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398542 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398534 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398526 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398518 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398500 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398479 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397759 A/Wisconsin/35/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397540 A/Ohio/56/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397516 A/Ohio/36/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397503 A/Indiana/104/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397446 A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397385 A/Indiana/138/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397351 A/Ohio/37/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397340 A/Indiana/150/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397089 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396299 A/Maryland/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396280 A/Indiana/144/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396208 A/Indiana/149/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396192 A/Ohio/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396183 A/Indiana/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396175 A/Ohio/80/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395874 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395866 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395718 A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395711 A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395357 A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395344 A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395270 A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395267 A/Ohio/65/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394937 A/Ohio/75/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jul 27, 2013 5:47 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI464502 A/Indiana/04/2013 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI464499 A/Indiana/05/2013 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI398123 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI404892 A/Iowa/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400102 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397395 A/Indiana/93/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397377 A/Indiana/123/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397363 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396269 A/Indiana/133/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395958 A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395950 A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395934 A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395921 A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395885 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395860 A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395852 A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395742 A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395330 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395327 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394936 A/Ohio/75/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394932 A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394920 A/Ohio/69/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394912 A/Indiana/132/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394905 A/Ohio/62/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393915 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393696 A/Indiana/20/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393687 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393666 A/Ohio/28/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Jul 27, 2013 5:48 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI460975 A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI451205 A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI448836 A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI447028 A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443110 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443107 A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443100 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI443097 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI441501 A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI427186 A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI426885 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI424076 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI414154 A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI406528 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI406505 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI404893 A/Iowa/16/2012 (A/H3N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI464501 A/Indiana/04/2013 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI464498 A/Indiana/05/2013 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI451230 A/swine/Ohio/A01208181/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446881 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446873 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446857 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446832 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446824 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI446736 A/swine/Ohio/A01349615/2013 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI414181 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI407274 A/Minnesota/18/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401715 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401659 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI401615 A/swine/Minnesota/A01301908/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI398545 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI398537 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397957 A/Ohio/88/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397943 A/Ohio/84/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397902 A/Hawaii/03/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397551 A/Ohio/86/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397535 A/Ohio/56/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397435 A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397421 A/Minnesota/15/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396197 A/Ohio/79/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396187 A/Ohio/77/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI396172 A/Ohio/80/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395930 A/swine/Ohio/12TOSU293/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395877 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395869 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395354 A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395340 A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395268 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI394928 A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI393916 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI393699 A/Ohio/64/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI394067 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1807.1 0.000000e+00 980/981 (99%)
EPI394917 A/Ohio/69/2012 (A/H3N2) segment 7 (MP) 1805.3 0.000000e+00 980/982 (99%)
EPI461015 A/swine/South Dakota/A01350803/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI460762 A/Indiana/07/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 976/976 (100%)
EPI453568 A/swine/Indiana/A01260230/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI451224 A/swine/Ohio/A01208180/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI446921 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI446913 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443536 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443528 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443512 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI443504 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI441498 A/swine/Ohio/A01349140/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI440749 A/swine/Indiana/A01432492/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433543 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433536 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433300 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433292 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433280 A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI433271 A/swine/Ohio/A01280357/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI427192 A/swine/Indiana/A01260169/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI426905 A/swine/Iowa/A01432308/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI426874 A/swine/Ohio/A01280112/2013 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414189 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414173 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414110 A/swine/Ohio/A01279763/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414104 A/swine/Ohio/A01279737/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414053 A/swine/Ohio/A01279640/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414050 A/swine/Ohio/A01279687/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI414038 A/swine/Ohio/A01279522/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408339 A/swine/Indiana/A01432186/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408210 A/swine/Indiana/A01260110/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408204 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI408198 A/swine/Indiana/A01260048/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI407026 A/swine/Ohio/A01279011/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406574 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406535 A/swine/Ohio/A01267959/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406471 A/swine/Indiana/A01260041/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI406468 A/swine/Indiana/A01260029/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI401623 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI401619 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI400107 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI400104 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398690 A/swine/North Carolina/A01270266/2012 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398529 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398503 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398150 A/swine/Ohio/25/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398039 A/West Virginia/09/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI398038 A/Ohio/38/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Aug 02, 2013 4:16 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Update

EPI463708 A/swine/Illinois/A01432795/2013 (A/H3N2) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI464503 A/Indiana/04/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI464500 A/Indiana/05/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI462227 A/Indiana/15/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI461883 A/Indiana/09/2013 (A/H3N2) segment 4 (HA) 3125.7 0.000000e+00 1698/1701 (99%)
EPI464870 A/Ohio/05/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI464511 A/Indiana/10/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI462224 A/Indiana/18/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461877 A/Indiana/08/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI460760 A/Indiana/07/2013 (A/H3N2) segment 4 (HA) 3120.1 0.000000e+00 1697/1701 (99%)
EPI461874 A/Indiana/06/2013 (A/H3N2) segment 4 (HA) 3114.6 0.000000e+00 1696/1701 (99%)
EPI462212 A/Indiana/17/2013 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1686/1689 (99%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI462215 A/Indiana/16/2013 (A/H3N2) segment 4 (HA) 3096.1 0.000000e+00 1684/1688 (99%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3094.3 0.000000e+00 1692/1701 (99%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446919 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446863 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI446830 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443558 A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI443526 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI440751 A/swine/Indiana/A01432492/2013 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433540 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433533 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433306 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI433298 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI424073 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI414178 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI406530 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401702 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401684 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401680 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI401667 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI400105 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398542 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398534 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398526 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398518 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398500 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI398479 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397759 A/Wisconsin/35/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397540 A/Ohio/56/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397516 A/Ohio/36/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397503 A/Indiana/104/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397446 A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397385 A/Indiana/138/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397351 A/Ohio/37/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397340 A/Indiana/150/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397089 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396299 A/Maryland/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396280 A/Indiana/144/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396208 A/Indiana/149/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396192 A/Ohio/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396183 A/Indiana/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396175 A/Ohio/80/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395874 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395866 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395718 A/swine/Indiana/A01104023/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395711 A/swine/Indiana/A01104016/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395357 A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395344 A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395270 A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Aug 02, 2013 4:18 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI463709 A/swine/Illinois/A01432795/2013 (A/H3N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI464502 A/Indiana/04/2013 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI464499 A/Indiana/05/2013 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI398123 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI404892 A/Iowa/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400102 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397395 A/Indiana/93/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397377 A/Indiana/123/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397363 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396269 A/Indiana/133/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395958 A/swine/Indiana/A00968379/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395950 A/swine/Indiana/A00968376/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395934 A/swine/Indiana/A00968370/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395921 A/swine/Ohio/12TOSU268/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395885 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395860 A/swine/Ohio/12TOSU464/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395852 A/swine/Ohio/12TOSU467/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395742 A/swine/Indiana/A00968386/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395330 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395327 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394936 A/Ohio/75/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394932 A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394920 A/Ohio/69/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394912 A/Indiana/132/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394905 A/Ohio/62/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393915 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393696 A/Indiana/20/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393687 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 106 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group