niman wrote:
Closest human H5N1 case to NA of emerging sub-clade
LOCUS CY062461 1350 bp cRNA linear VRL 30-APR-2010
DEFINITION Influenza A virus (A/Egypt/N14604/2009(H5N1)) segment 6 sequence.
ACCESSION CY062461
VERSION CY062461.1 GI:295443478
KEYWORDS .
SOURCE Influenza A virus (A/Egypt/N14604/2009(H5N1))
ORGANISM Influenza A virus (A/Egypt/N14604/2009(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1350)
AUTHORS Elassal,E.M., Kandeel,A., Abdelghani,A.S., Elsayed,N.M.,
Gomaa,A.A., Younan,M., Earhart,K.C., Turner,M., Pimentel,G. and
Barthel,R.V.
TITLE Influenza A subtype H5N1 viruses from Egypt
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1350)
AUTHORS Elassal,E.M., Kandeel,A., Abdelghani,A.S., Elsayed,N.M.,
Gomaa,A.A., Younan,M., Earhart,K.C., Turner,M., Pimentel,G. and
Barthel,R.V.
TITLE Direct Submission
JOURNAL Submitted (30-APR-2010) Viral and Zoonotic Diseases Research
Program, U.S. Naval Medical Research Unit No. 3, Extension of
Ramses Street, Nasr City, Cairo 11517, Egypt
FEATURES Location/Qualifiers
source 1..1350
/organism="Influenza A virus (A/Egypt/N14604/2009(H5N1))"
/mol_type="viral cRNA"
/strain="A/Egypt/N14604/2009"
/serotype="H5N1"
/isolation_source="Throat Swab"
/host="human; gender F; age 21"
/db_xref="taxon:760594"
/segment="6"
/country="Egypt: Gharbeya"
/collection_date="19-Dec-2009"
gene 1..1350
/gene="NA"
CDS 1..1350
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ADG21424.1"
/db_xref="GI:295443479"
/translation="MNPNQKIITIGSICMVIGIASLMLQIGNMISIWVSHSIQTGNQC
QDESISNTKFLTEKAVASVTLAGNSSLCPISGWAVYSKDNSIRIGSKGDVFVIREPFI
SCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWS
ASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNIMRTQESECACVNGSC
FTVMTDGPSSGQASYKIFKMEKGKVVKSVELDAPNYHYEECSCYPDAGEITCVCRDNW
HGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVFPNGAYGVKGFSFKYG
NGVWIGRTKSTNSRSGFEMIWDPNGWTGTDSSFSVKQDIVAITDWSGYSGSFVQHPEL
TGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNGDTVSWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa atcagaagat aataaccatc ggatcaatct gtatggtaat tgggatagct
61 agcttaatgt tacaaattgg aaacatgatc tcaatatggg tcagtcattc aattcagaca
121 gggaatcaat gccaagatga atcaatcagc aacactaaat ttcttactga gaaagctgtg
181 gcttcagtaa cattagcggg caattcatct ctttgtccca ttagcggatg ggctgtgtac
241 agtaaggata acagcataag gatcggttcc aagggggatg tgtttgttat aagagagcca
301 ttcatctcat gctcccactt ggaatgcaga actttctttt taacccaggg agccttactg
361 aatgacaagc actccaatgg aactgtcaaa gacagaagcc ctcacagaac attaatgagt
421 tgtcctgtgg gtgaggctcc ctccccatat aactcaaggt ttgagtctgt tgcttggtca
481 gcaagtgctt gccatgatgg caccagttgg ttgacaattg gaatttctgg tccagacaat
541 ggggctgtgg ctgtattgaa atacaatggc ataataacag acaccatcaa gagttggagg
601 aacaacataa tgagaactca agagtctgaa tgtgcatgtg taaatggctc ttgctttact
661 gtaatgactg atggaccaag tagtgggcag gcatcatata agatcttcaa aatggaaaag
721 ggaaaagtgg ttaaatcagt cgaattggat gctcctaatt atcactatga ggagtgctcc
781 tgttatcctg atgccggcga aatcacatgt gtgtgcaggg ataattggca tggatcaaat
841 aggccatggg tatctttcaa tcaaaatttg gagtatcaaa taggatatat atgcagtgga
901 gttttcggag acaatccacg ccccaatgat ggaacaggta gttgtggtcc ggtgttccct
961 aacggggcat atggggtaaa agggttttca tttaaatacg gcaatggtgt ttggatcggg
1021 agaaccaaaa gcactaattc caggagcggc tttgaaatga tttgggaccc aaatgggtgg
1081 actggaacgg acagtagctt ttcagtgaag caagatatcg tagcaataac tgattggtca
1141 ggatatagcg ggagttttgt ccagcatcca gaactgacag gattagattg cataagacct
1201 tgtttctggg ttgagttaat cagagggcgg cctaaagaga gcacaatttg gaccagtgga
1261 agcagcatat ctttttgtgg ggtaaatggt gacactgtta gttggtcttg gccagacggt
1321 gctgagttgc cattcaccat tgacaagtaa
WHO update on above case:
21 December 2009 -The Ministry of Health of Egypt has reported a new laboratory confirmed human case of avian influenza A(H5N1) on 19 December 2009.
The case is a 21 year old female from the El Tanta District of Gharbia Governorate. She developed symptoms of fever and cough on 15 December 2009.
She was admitted to Tanta Fever Hospital where she received oseltamivir treatment on the same day. She is in a stable condition. Investigation revealed that the case had close contact with dead poultry and was involved in slaughtering sick birds.
The case was confirmed by the Egyptian Central Public Health Laboratories, a National Influenza Center of the WHO Global Influenza Surveillance Network (GISN).
Of the 90 laboratory confirmed cases of Avian influenza A(H5N1) reported in Egypt, 27 have been fatal.
http://www.who.int/csr/don/2009_12_21/en/index.html