Rhiza Labs FluTracker Forum

Recently released sequence from Russia has D225G. New reports are coming in daily and the level of H1N1 in Russia is very high.

LOCUS GU211219 1752 bp cRNA linear VRL 19-NOV-2009
DEFINITION Influenza A virus (A/Vladivostok/01/2009(H1N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION GU211219
VERSION GU211219.1 GI:269122726
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Vladivostok/01/2009(H1N1))
ORGANISM Influenza A virus (A/Vladivostok/01/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1752)
AUTHORS Susloparov,I.M., Durymanov,A.G., Alekseev,A.Y., Sivay,M.V.,
Sharshov,K.A., Shestopalov,A.M., Sayfutdinova,S.G. and Drozdov,I.G.
TITLE Isolation and identification of a novel swine-origin H1N1 influenza
A virus in Russia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1752)
AUTHORS Susloparov,I.M., Durymanov,A.G., Shestopalov,A.M. and Drozdov,I.G.
TITLE Direct Submission
JOURNAL Submitted (19-NOV-2009) Federal State Research Institution - State
Research Center of Virology and Biotechnology Vector, Federal
Service for Surveillance on Consumer Rights Protection and Human
Well-Being, Koltsovo, Novosibirsk Region 630559, Russia
COMMENT GenBank Accession Numbers GU211219-GU211226 represent sequences
from the 8 segments of Influenza A virus
(A/Vladivostok/01/2009(H1N1)).

Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..1752
/organism="Influenza A virus
(A/Vladivostok/01/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Vladivostok/01/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:693581"
/segment="4"
/country="Russia"
/collection_date="2009"
/note="lineage: swl"
gene 21..1721
/gene="HA"
CDS 21..1721
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ACZ27800.1"
/db_xref="GI:269122727"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFV
GSSRYSKEFKPEIAIRPKVRGQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI"
sig_peptide 21..71
/gene="HA"
mat_peptide 72..1052
/gene="HA"
/product="HA1"
mat_peptide 1053..1718
/gene="HA"
/product="HA2"
ORIGIN
1 ggaaaacaaa agcaacaaaa atgaaggcaa tactagtagt tctgctatat acatttgcaa
61 ccgcaaatgc agacacatta tgtataggtt atcatgcgaa caattcaaca gacactgtag
121 acacagtact agaaaagaat gtaacagtaa cacactctgt taaccttcta gaagacaagc
181 ataacgggaa actatgcaaa ctaagagggg tagccccatt gcatttgggt aaatgtaaca
241 ttgctggctg gatcctggga aatccagagt gtgaatcact ctccacagca agctcatggt
301 cctacattgt ggaaacatct agttcagaca atggaacgtg ttacccaggg gatttcatcg
361 attatgagga gctaagagag caattgagct cagtgtcatc atttgaaagg tttgagatat
421 tccccaagac aagttcatgg cccaatcatg actcgaacaa aggtgtaacg gcagcatgtc
481 ctcatgctgg agcaaaaagc ttctacaaaa atttaatatg gctagttaaa aaaggaaatt
541 catacccaaa gctcagcaaa tcctacatta atgataaagg gaaagaagtc ctcgtgctat
601 ggggcattca ccatccatct actagtgctg accaacaaag tctctatcag aatgcagatg
661 catatgtttt tgtggggtca tcaagataca gcaaggagtt caagccggaa atagcaataa
721 gacccaaagt gaggggtcaa gaagggagaa tgaactatta ctggacacta gtagagccgg
781 gagacaaaat aacattcgaa gcaactggaa atctagtggt accgagatat gcattcgcaa
841 tggaaagaaa tgctggatct ggtattatca tttcagatac accagtccac gattgcaata
901 caacttgtca gacacccaag ggtgctataa acaccagcct cccatttcag aatatacatc
961 cgatcacaat tggaaaatgt ccaaaatatg taaaaagcac aaaattgaga ctggccacag
1021 gattgaggaa tgtcccgtct attcaatcta gaggcctatt tggggccatt gccggtttca
1081 ttgaaggggg gtggacaggg atggtagatg gatggtacgg ttatcaccat caaaatgagc
1141 aggggtcagg atatgcagcc gacctgaaga gcacacagaa tgccattgac gagattacta
1201 acaaagtaaa ttctgttatt gaaaagatga atacacagtt cacagcagta ggtaaagagt
1261 tcaaccacct ggaaaaaaga atagagaatt taaataaaaa agttgatgat ggtttcctgg
1321 acatttggac ttacaatgcc gaactgttgg ttctattgga aaatgaaaga actttggact
1381 accacgattc aaatgtgaag aacttatatg aaaaggtaag aagccagcta aaaaacaatg
1441 ccaaggaaat tggaaacggc tgctttgaat tttaccacaa atgcgataac acgtgcatgg
1501 aaagtgtcaa aaatgggact tatgactacc caaaatactc agaggaagca aaattaaaca
1561 gagaagaaat agatggggta aagctggaat caacaaggat ttaccagatt ttggcgatct
1621 attcaactgt cgccagttca ttggtactgg tagtctccct gggggcaatc agtttctgga
1681 tgtgctctaa tgggtctcta cagtgtagaa tatgtattta acattaggat ttcagaagca
1741 tgagaaaaac ac

Google languages does not have Niman as language that can be translated! So it could be said that this variant is in Russia, how far spread and prevalent is still up for grabs.

Niman what is the list of countries with this now? and has this mutation been with us since the start?

Those below are at Genbank. Sequences from Ukraine and Australia are at GISAID
gb|GU211219.1| Influenza A virus (A/Vladivostok/01/2009(H1N1)... 32.2 12
gb|GU189649.1| Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(... 32.2 12
gb|GU112090.1| Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(... 32.2 12
gb|GU108486.1| Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N... 32.2 12
gb|CY047083.1| Influenza A virus (A/Catalonia/NS2008/2009(H1N... 32.2 12
gb|CY047080.1| Influenza A virus (A/Catalonia/NS2001/2009(H1N... 32.2 12
gb|CY047074.1| Influenza A virus (A/Catalonia/NS1706/2009(H1N... 32.2 12
gb|GU014750.1| Influenza A virus (A/Hiroshima/201/2009(H1N1))... 32.2 12
gb|GQ915017.1| Influenza A virus (A/Sao Paulo/53206/2009(H1N1... 32.2 12
gb|GQ457487.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 32.2 12
gb|GQ379822.1| Influenza A virus (A/Mexico/InDRE4114/2009(H1N... 32.2 12
gb|GQ374893.1| Influenza A virus (A/reassortant/IDCDC-RG18(Te... 32.2 12
gb|GQ280121.1| Influenza A virus (A/reassortant/NIBRG-121(Cal... 32.2 12
gb|GQ229348.1| Influenza A virus (A/swine/Hong Kong/NS857/200... 32.2 12
gb|GQ229261.1| Influenza A virus (A/swine/Hong Kong/NS837/200... 32.2 12
gb|GQ232076.1| Influenza A virus (A/Texas/11/2009(H1N1)) segm... 32.2 12
gb|GQ200237.1| Influenza A virus (A/Georgia/01/2009(H1N1)) se... 32.2 12
gb|GQ162194.1| Influenza A virus (A/Mexico/3955/2009(H1N1)) s... 32.2 12
gb|GQ160568.1| Influenza A virus (A/New York/04/2009(H1N1)) s... 32.2 12
gb|GQ132145.1| Influenza A virus (A/Mexico/InDRE4114/2009(H1N... 32.2 12

I tried to post an article by Washington Post. Looks like Norway has it too.

What does this mean? Has this always been there, like the other countries, like Australia, Brazil, Argentina, etc?

Is it here yet?

Commentary

http://www.recombinomics.com/News/11200 ... D225G.html

Sweden has had it, too, per Treyfish's post here:10:27 today hat-tip Treyfish
http://www.flutrackers.com/forum/showpo ... stcount=29


Svinfluensan mutation
The virus can reach further into the lungs
Swine influenza virus has mutated.
2009-11-20
The new variant, which appeared in both Sweden and Norway, can reach deeper into the lungs and be more serious for the patient.

But Norwegian and Swedish health authorities say there is no reason to panic.

Norway has been more affected by the new influenza A/H1N1 than Sweden and so far 23 people have died in the impact of the virus and at least 700 000 have fallen ill.

The Norwegian institute of health (FHI) is monitoring the situation closely and have done extensive testing of the virus from both diseased and deceased patients, writes VG.

"After further down into the lungs"
Today at a press conference revealed FHI that Norway seems to have suffered a more aggressive virus than many other countries.

They found evidence that the swine flu virus has mutated into at least three cases, and that it takes longer into the lungs than in normal swine influenza. The results have been presented to the World Health Organization.

- The mutant virus causes a mild illness in most, but can be serious for a few. This variant can reach further into the lungs than the original version, "said Director Geir Stene-Larsen on the National Public Health Institute in a press conference on Friday, according to VG.

Even in Sweden
The same variant of swine influenza virus detected in Norway has also been found in Sweden, in both seriously ill, mildly ill and in people who are not sick at all, writes TT. But neither the Swedish Institute of Infectious Disease Control (SMI) or the WHO has so far found no evidence of changes in the circulating strains that make the new flu more aggressive.

The signs are that the vaccine and Tamiflu works the same way against the new, mutated virus. And the Norwegian Health Organization says there are no indications that more will be affected by the mutated H1N1 virus.

Since, as we have seen so far, only occurred in patients who remained hospitalized for so experts expect that it is less contagious.

- For those of us who are now seeing the disease around us, and for those who become sick in the future, so might not mean this so much. We expect that most will have a mild form of the disease, says health director Bjørn-Inge Larsen to NRK.
http://www.aftonbladet.se/nyheter/article6160420.ab

- The mutant virus causes a mild illness in most, but can be serious for a few. This variant can reach further into the lungs than the original version, "said Director Geir Stene-Larsen on the National Public Health Institute in a press conference on Friday, according to VG.

Even in Sweden
The same variant of swine influenza virus detected in Norway has also been found in Sweden, in both seriously ill, mildly ill and in people who are not sick at all, writes TT. But neither the Swedish Institute of Infectious Disease Control (SMI) or the WHO has so far found no evidence of changes in the circulating strains that make the new flu more aggressive.

Dr Niman,
In your commentary, you described the patients in ICU as dying. I only read that their condition was serious. They should not be termed "dying" prematurely.

This next article from Sweden states that not all of their patients with this mutation are even seriously ill.