Rhiza Labs FluTracker Forum

The place to discuss the flu

Support This Site

 

Old Comment Archive

It is currently Thu Sep 02, 2010 10:34 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 115 posts ]  Go to page Previous  1 ... 6, 7, 8, 9, 10, 11, 12  Next
Author Message
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 6:55 pm 
Offline

Joined: Fri Nov 13, 2009 4:17 pm
Posts: 322
wotan wrote:
Keep in mind this is not Captain Tripps.

Ahhh. Stephen Kings "The Stand". Long time. Can't believe I forgot about that book in the midst of all this. No, this isn't even close. And even if Bird & Swine mated it wouldn't get that bad. But it would get a lot closer. That's the one that wakes me up in a sweat sometimes - "The Flying Pig"


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 7:14 pm 
Offline

Joined: Wed Aug 19, 2009 2:04 pm
Posts: 265
wotan wrote:
4Peas wrote:
ms4920 wrote:
So as I am reading all of this, it seems like the d225 mutation has been in other countries, or is in. So it is here, right? What exactly do you think, Dr. Niman, will be our outcome and is the vaccine still effective.
Should I go out and spend my money now before we all die? Do you see this turning into 1918 at this point or are we there too?
Just confused and sad that it took this forum to figure out what is going on and no one is still telling us the truth. Yes it is getting more coverage, but how will that protect us.
I guess what I am asking is will we see this as severely here in the US as in the Ukraine.
Thank you


With that question I didn't know whether to laugh or cry - I don't know about spending all my money, but I'm in serious trouble if it comes to stocking up necessities. No flu shots available for myself - 50 with diabetes, but I have found flumist for 3 of my kids for this coming Monday - hoping it will still be effective. My youngest is allergic to eggs and I had been told by her ped that no flu vacs for her as she could have a serious reaction. I guess all we can do is wait for more information to come to light. Thank God for Dr. Niman, else we'd really be in the dark.


Keep in mind this is not Captain Tripps.


Yeah, I remember the book now and you're right.


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 8:52 pm 
Offline
User avatar

Joined: Tue Aug 11, 2009 2:58 pm
Posts: 1325
Location: Katy, TX
The Mountains Voice wrote:
wotan wrote:
Keep in mind this is not Captain Tripps.

Ahhh. Stephen Kings "The Stand". Long time. Can't believe I forgot about that book in the midst of all this. No, this isn't even close. And even if Bird & Swine mated it wouldn't get that bad. But it would get a lot closer. That's the one that wakes me up in a sweat sometimes - "The Flying Pig"


What's scary though is how prescient King was about some things, such as trying to keep the public from panicking over summer outbreak of flu by stating that some people had died but that they had underlying conditions.... :shock:

_________________
I am not a doctor, virologist, or any of type of medical/life sciences professional.

I am a layman with a background in the physical sciences.


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 9:07 pm 
Offline

Joined: Wed Aug 19, 2009 10:38 am
Posts: 968
4Peas wrote:
My youngest is allergic to eggs and I had been told by her ped that no flu vacs for her as she could have a serious reaction. I guess all we can do is wait for more information to come to light. Thank God for Dr. Niman, else we'd really be in the dark.


I have twice posted research, in medical journals, that egg allergies are either not a concern, or one that can be easily tested for both pre-and post-vaccination.

I don't understand why doctors can't do the same research I can do at home.


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 9:10 pm 
Offline
User avatar

Joined: Tue Aug 11, 2009 2:58 pm
Posts: 1325
Location: Katy, TX
VJP wrote:
4Peas wrote:
My youngest is allergic to eggs and I had been told by her ped that no flu vacs for her as she could have a serious reaction. I guess all we can do is wait for more information to come to light. Thank God for Dr. Niman, else we'd really be in the dark.


I have twice posted research, in medical journals, that egg allergies are either not a concern, or one that can be easily tested for both pre-and post-vaccination.

I don't understand why doctors can't do the same research I can do at home.

My little one has a mild egg allergy, not so bad that we stopped giving her eggs and she has never had a reaction to the 4 flu shots she has had in her life. zyrtec seems to help keep her allergies (egg and milk) at bay.

_________________
I am not a doctor, virologist, or any of type of medical/life sciences professional.

I am a layman with a background in the physical sciences.


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 9:40 pm 
Offline

Joined: Wed Aug 19, 2009 2:33 pm
Posts: 1841
My son was allergic to eggs and so the pediatrician had us go to an allergist to receive the MMR vaccine (this was years ago). Call an allergist to see what they recommend before writing off the h1n1 vaccine as an option.


Concerned about egg allergy and vaccine? This might give you some answers.
It is about the MMR vaccine, but same issue as the h1n1 vaccine.

http://parenting.ivillage.com/tp/tpheal ... 50,00.html
excerpt:
Quote:
Therefore, investigators at Arkansas Children's Hospital and John's Hopkins teamed up to answer this question. In May of 1995, they published their study which showed that children who are allergic to eggs do not seem to be at increased risk for reactions to the MMR. Their study, along with other published studies, have led to the American Academy of Pediatrics to hold discussions about this issue. Although the 1994 policy on the MMR in children with allergy to eggs still stands, it is anticipated that this will be modified sometime soon to allow for all children to receive the MMR without added injections or testing.

Read more: http://parenting.ivillage.com/tp/tpheal ... z0XMMRigTu


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Thu Nov 19, 2009 11:10 pm 
Offline
User avatar

Joined: Wed Aug 19, 2009 10:12 pm
Posts: 1260
Quote:
Keep in mind this is not Captain Tripps.

When we all start seeing Mother Abigail in our dreams, I think it will be time for concern. :grin:

Quote:
4Peas wrote:
My youngest is allergic to eggs and I had been told by her ped that no flu vacs for her as she could have a serious reaction.

4 Peas - This might interest you...

Per the Joint Task Force on Practice Parameters, representing the American Academy of Allergy, Asthma and Immunology; the American College of Allergy, Asthma and Immunology; and the Joint Council of Allergy, Asthma and Immunology:

Quote:
Most Patients With Vaccine Allergy May Be Safely Vaccinated

The guidelines provide general and vaccine-specific recommendations for skin testing to vaccines and components, serum-specific immunoglobulin E (IgE) in vitro antibody testing, serologic testing for protective antibody responses to vaccines, vaccine administration, and avoidance. If this practice parameter is implemented, most patients who avoid vaccination because of allergy concerns will be able to be vaccinated appropriately.

Of approximately 235 million doses of vaccines given annually in the United States, only 1 dose per million causes anaphylaxis. Furthermore, death caused by vaccine-induced anaphylaxis is extremely uncommon.

"Persons with a history of allergy to egg or a past reaction to an influenza vaccine may still be able to receive the H1N1 vaccine or the seasonal flu vaccine safely," said co-chief editor James T. Li, MD, Mayo Clinic professor of medicine and chair, Division of Allergy and Immunology. "I believe that anyone with this concern should check with their doctor and consult with an allergist."

[SNIP]

# IgE-mediated reactions to vaccines are more often caused by vaccine components, such as gelatin or egg protein, vs the immunizing agent itself. Gelatin is commonly used in MMR and varicella vaccines. MMR vaccine contains no significant amount of egg protein, but influenza and yellow fever vaccines have higher concentrations of egg protein. The influenza vaccine has been safely administered to patients with known egg allergy by giving 10% of the dose, followed by the rest of the dose 30 minutes later.

# Patients with an anaphylactic reaction after vaccination should first undergo allergy testing against the vaccine by use of the prick method. If this prick test result is negative, intradermal testing with a 1:100 vaccine dilution should be performed. Intradermal testing can also include suspected vaccine component allergens.

# If the result of the intradermal test with the vaccine is negative, the likelihood of an IgE-mediated reaction is very low, and the patient may resume routine vaccination. However, as a precaution, the patient should be kept under observation for at least 30 minutes, with epinephrine and other emergency treatment available.

http://cme.medscape.com/viewarticle/710958


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Fri Nov 20, 2009 11:47 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
D225G also now in Russia

LOCUS GU211219 1752 bp cRNA linear VRL 19-NOV-2009
DEFINITION Influenza A virus (A/Vladivostok/01/2009(H1N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION GU211219
VERSION GU211219.1 GI:269122726
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Vladivostok/01/2009(H1N1))
ORGANISM Influenza A virus (A/Vladivostok/01/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1752)
AUTHORS Susloparov,I.M., Durymanov,A.G., Alekseev,A.Y., Sivay,M.V.,
Sharshov,K.A., Shestopalov,A.M., Sayfutdinova,S.G. and Drozdov,I.G.
TITLE Isolation and identification of a novel swine-origin H1N1 influenza
A virus in Russia
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1752)
AUTHORS Susloparov,I.M., Durymanov,A.G., Shestopalov,A.M. and Drozdov,I.G.
TITLE Direct Submission
JOURNAL Submitted (19-NOV-2009) Federal State Research Institution - State
Research Center of Virology and Biotechnology Vector, Federal
Service for Surveillance on Consumer Rights Protection and Human
Well-Being, Koltsovo, Novosibirsk Region 630559, Russia
COMMENT GenBank Accession Numbers GU211219-GU211226 represent sequences
from the 8 segments of Influenza A virus
(A/Vladivostok/01/2009(H1N1)).

Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..1752
/organism="Influenza A virus
(A/Vladivostok/01/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Vladivostok/01/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:693581"
/segment="4"
/country="Russia"
/collection_date="2009"
/note="lineage: swl"
gene 21..1721
/gene="HA"
CDS 21..1721
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ACZ27800.1"
/db_xref="GI:269122727"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFV
GSSRYSKEFKPEIAIRPKVRGQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI"
sig_peptide 21..71
/gene="HA"
mat_peptide 72..1052
/gene="HA"
/product="HA1"
mat_peptide 1053..1718
/gene="HA"
/product="HA2"
ORIGIN
1 ggaaaacaaa agcaacaaaa atgaaggcaa tactagtagt tctgctatat acatttgcaa
61 ccgcaaatgc agacacatta tgtataggtt atcatgcgaa caattcaaca gacactgtag
121 acacagtact agaaaagaat gtaacagtaa cacactctgt taaccttcta gaagacaagc
181 ataacgggaa actatgcaaa ctaagagggg tagccccatt gcatttgggt aaatgtaaca
241 ttgctggctg gatcctggga aatccagagt gtgaatcact ctccacagca agctcatggt
301 cctacattgt ggaaacatct agttcagaca atggaacgtg ttacccaggg gatttcatcg
361 attatgagga gctaagagag caattgagct cagtgtcatc atttgaaagg tttgagatat
421 tccccaagac aagttcatgg cccaatcatg actcgaacaa aggtgtaacg gcagcatgtc
481 ctcatgctgg agcaaaaagc ttctacaaaa atttaatatg gctagttaaa aaaggaaatt
541 catacccaaa gctcagcaaa tcctacatta atgataaagg gaaagaagtc ctcgtgctat
601 ggggcattca ccatccatct actagtgctg accaacaaag tctctatcag aatgcagatg
661 catatgtttt tgtggggtca tcaagataca gcaaggagtt caagccggaa atagcaataa
721 gacccaaagt gaggggtcaa gaagggagaa tgaactatta ctggacacta gtagagccgg
781 gagacaaaat aacattcgaa gcaactggaa atctagtggt accgagatat gcattcgcaa
841 tggaaagaaa tgctggatct ggtattatca tttcagatac accagtccac gattgcaata
901 caacttgtca gacacccaag ggtgctataa acaccagcct cccatttcag aatatacatc
961 cgatcacaat tggaaaatgt ccaaaatatg taaaaagcac aaaattgaga ctggccacag
1021 gattgaggaa tgtcccgtct attcaatcta gaggcctatt tggggccatt gccggtttca
1081 ttgaaggggg gtggacaggg atggtagatg gatggtacgg ttatcaccat caaaatgagc
1141 aggggtcagg atatgcagcc gacctgaaga gcacacagaa tgccattgac gagattacta
1201 acaaagtaaa ttctgttatt gaaaagatga atacacagtt cacagcagta ggtaaagagt
1261 tcaaccacct ggaaaaaaga atagagaatt taaataaaaa agttgatgat ggtttcctgg
1321 acatttggac ttacaatgcc gaactgttgg ttctattgga aaatgaaaga actttggact
1381 accacgattc aaatgtgaag aacttatatg aaaaggtaag aagccagcta aaaaacaatg
1441 ccaaggaaat tggaaacggc tgctttgaat tttaccacaa atgcgataac acgtgcatgg
1501 aaagtgtcaa aaatgggact tatgactacc caaaatactc agaggaagca aaattaaaca
1561 gagaagaaat agatggggta aagctggaat caacaaggat ttaccagatt ttggcgatct
1621 attcaactgt cgccagttca ttggtactgg tagtctccct gggggcaatc agtttctgga
1681 tgtgctctaa tgggtctcta cagtgtagaa tatgtattta acattaggat ttcagaagca
1741 tgagaaaaac ac

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Fri Nov 20, 2009 3:38 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
The "mutation" in Norway is also D225G

http://www.recombinomics.com/News/11200 ... raine.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Receptor Binding Doman Changes - D225
PostPosted: Fri Nov 20, 2009 4:42 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
http://www.sbs.com.au/news/article/1136 ... -flu-virus


The World Health Organisation says a mutation had been found in samples of the swine flu virus taken following the first two deaths from the pandemic in Norway.

."The Norwegian Institute of Public Health has informed WHO of a mutation detected in three H1N1 viruses," the WHO said in a briefing note on Friday.

"The viruses were isolated from the first two fatal cases of pandemic influenza in the country and one patient with severe illness," it said, although it added that no further instances were found in tests.

The WHO revealed that a similar mutation had been observed in Brazil, China, Japan, Mexico, Ukraine, and the United States as early as April, but underlined that there was no evidence of more infections or more deaths as a result.

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 115 posts ]  Go to page Previous  1 ... 6, 7, 8, 9, 10, 11, 12  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 3 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group