Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Jun 19, 2013 7:53 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 286 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6 ... 29  Next
Author Message
 Post subject: Re: flu-A evolution
PostPosted: Fri Oct 30, 2009 3:31 pm 
Offline
User avatar

Joined: Wed Aug 26, 2009 4:15 pm
Posts: 635
gsgs wrote:
this looks too important to have been missed


average ratio synonymous/nonsynonymous differences
in 5 chosen distant avian virus pairs (segments 1,2,3,5) = 6.22
(Brevig/1918 qualifies as avian here)

same for 4 mammalean flu-virus-pairs = 2.24

over 50-200 years



how to explain ?

is there less freedom/opportunity , more constrainsts for
flu-evolution in birds ? Many amino-acid changes
which are possible in mammals don't work in birds ?

Or is it just slower and takes longer in birds ?

In any case, there are limitations for flu-evolution
in birds which are not seen in mammals


Let’s separate raw experimental data and tentative explanations.

You observed two remarlable features regarding influenza genetics:

1. The nucleotide substitution rates are remarkable low on a number of avian influenza genes.

2. The average ratio synonymous/nonsynonymous (S/N) is also quite distinct:
-Avian influenza: S/N=6.22
- Mammal influenza: S/N=2.24,
for this particular sample.

The larger S/N could possibly be explained by different evolution stages on avian and mammal hosts. Only nonsynonymous mutations change the resulting RNA amino acid expression and, as a consequence, the whole biochemical expression of the resulting virions.

I understand that evolutionary pressure tends to privilege nonsynonymous mutations, those capable to modify real virus metabolism. That is the conceptual reason for synonymous mutations use as a “molecular clock”. These changes are rather “environement independent”.

If ever one of the avian genes reached the statis regime, the gene is already “optimized”, fewer nonsynonymous mutations are desirable and tend to accumulate.

Taubenberger et. al 2004 (1)
Quote:
Comparison of the pre-1918 avian strains to the avian consensus sequences show that they have 9/150 (6%) differences from the avian consensus strain, 6/150 (4%) from the North American avian consensus strain, and 12/150 (7.9%) from the Eurasian avian consensus strain. Over these 150 nucleotides, the 1918 strain NP differs from that of the pre-1918 birds at 21 nucleotides (13.9%); 20 of the differences are synonymous and 1 is nonsynonymous. Both the number of differences and the S/N ratio are similar to the relationship of the 1918 strain NP to modern avian strain sequences.


Quote:
(vii) Comparison of 4-fd sites. We examined the numbers of changes at sites that are fourfold degenerate (4-fd). These sites can have any of the four bases, with no resulting amino acid replacement. Such sites have been shown to evolve nearly as rapidly as pseudogenes, the most rapidly evolving sequences in genomes. If influenza virus genes have been evolving in birds for long enough to reach evolutionary stasis (35), as is suggested by the high S/N ratios described above, one would predict that at many of the sites where fourfold degeneracy is possible all four bases would be present in the avian clade unless the constraints of RNA secondary structure limit the accumulation of synonymous changes.
(1)

(1) Novel Origin of the 1918 Pandemic Influenza Virus Nucleoprotein Gene
Ann H. Reid, Thomas G. Fanning, Thomas A. Janczewski, Raina M. Lourens, and Jeffery K. Taubenberger*
http://jvi.asm.org/cgi/content/full/78/22/12462[/quote]


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Fri Oct 30, 2009 4:43 pm 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2268457/
Phylogenetic Evidence against Evolutionary Stasis and Natural Abiotic Reservoirs of Influenza A Virus

Several additional cases with findings that seem at odds with the biology of influenza virus, including modern-looking avian influenza virus RNA sequences from an archival goose specimen collected in 1917 (T. G. Fanning, R. D. Slemons, A. H. Reid, T. A. Janczewski, J. Dean, and J. K. Taubenberger, J. Virol. 76:7860-7862, 2002), can also be explained by laboratory contamination or other experimental errors. Many putative examples of evolutionary stasis in influenza A virus appear to be due to laboratory artifacts.

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Fri Oct 30, 2009 6:11 pm 
Offline
User avatar

Joined: Wed Aug 26, 2009 4:15 pm
Posts: 635
gsgs wrote:
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2268457/
Phylogenetic Evidence against Evolutionary Stasis and Natural Abiotic Reservoirs of Influenza A Virus

Let's drop this paper for a while.

If those lab erros does not affect your previous data, let's go ahead without it.
The attempt explanation to smaller S/N for mammalian hosts still holds.
Bigger S/N <=> closer to stasis (not yet reached).


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sat Oct 31, 2009 6:33 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
> The larger S/N could possibly be explained by different evolution stages
> on avian and mammal hosts. Only nonsynonymous mutations change the resulting RNA
> amino acid expression and, as a consequence, the whole biochemical expression of the
> resulting virions.

yes, but I think it's not about the host evolution. Fla-A evolves in birds, only accidently
it goes to mammals. It should be adapted better to birds and thus evolve with
larger diversity in birds, also on the amino-acid level.

> I understand that evolutionary pressure tends to privilege nonsynonymous mutations,

in humans we have bigger pressure from immunity. So there are more non-synonymous
changes in HA(=4) and NA(=6). But usually not in the inner segments 1,2,3,5
Although, we also have cell-based immunity (how is it in birds ?)

> those capable to modify real virus metabolism. That is the conceptual reason for
> synonymous mutations use as a “molecular clock”. These changes are rather
> “environement independent”.
> If ever one of the avian genes reached the statis regime,

where/what is it ? How can it be reached ?
I think this "stasis" word was created long ago, when they had much fewer sequencing.
The Worobey article argues that it doesn't exist

> the gene is already “optimized”,
> fewer nonsynonymous mutations are desirable and tend to accumulate.

they still occur. It's only optimized wrt. to the environment, when that changes,
(other habits, bigger swine and turkey farms,...) then the optimization must change too.

We don't see these optimal genes, which can be distinguished from others.
The process of low non-synonymous mutations seems to depend on the host,
not the sequence itself.

In birds it should also be adapted to many different species

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sat Oct 31, 2009 7:26 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
Thinking again... I'm not so happy with what I just wrote
I'm not so sure about this "stasis" in birds on the protein-level yet.
I'll have to look at statistics, rewrite programs,...

I'm looking at PB1 now, with only 6 changes between
1918 and the Dutch chickens from 2003

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sat Oct 31, 2009 12:32 pm 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
mammalean flu also acquires more A,T nucleotides over
the decades. Is this related ?

Avian viruses are reluctant (or just slow ?)
to get new non-synonymous mutations

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sun Nov 01, 2009 3:09 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
on the amino-acid level, wrt. protein-changes only,
and considering only segments, not full viruses


does flu in birds evolve away from the great common
ancesters or does it oscillate around some
"index"-sequence ?

the amino-acid distance (#differences) does it increase
or almost stay constant ?

is there basically just one avian flu only in most segments ?
(not in segments 4,6,8)
and avian flu isn't capable to form this increasing diversity
that we see in human and swine flu ?


or is it just slower

or did essentially different segments exist before
but all except one died out


--------------------------

yes, on the nucleotide-level, we do see these bottlenecks also in birds,
points in flu evolution known from human pandemics, when one virus
in one host reassorts and becomes the ancestor of all
subsequent flu, causing other strains to die out.
Almost all avian (and thus also human,swine) come from
one or several such events 100-300 hundred years ago,
~1830,... depends on the segment. Not for 4,6,8

see threads at FT or PFS

_________________
no patents on genes, publish the GISAID sequences !


Last edited by gsgs on Sun Nov 01, 2009 4:40 am, edited 1 time in total.

Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sun Nov 01, 2009 3:35 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
if the hypothesis of oscillating avian amino-acid evolution around
an index-sequence is correct, then what is that index-sequence ?

let me try:


Code:

>A/Index/birds/notime(H0N0)
PB2:MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADPLASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN}
PB1:MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFENSCLETMEVVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANESGRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLANIDLKYFNESTRKKIEKIRPLLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDTQIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESVNNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK}
PA:MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSSLENFRAYVDGFEPNGCIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNMKKTSQLKWALGENMAPEKVDFEDCKDVSDLKQYDSDEPESRSLASWIQSEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALK}
NP:MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDYEGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVVPRGQLSTRGVQIASNENMETMDSSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPFERATIMAAFTGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN}
M1:MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK}
NS1:MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTDEDVKNAIGVLIGGLEWNDNTVRVSETLQRFAWRSSDEDGRPPLPPKQKRKMARTIESEVR


_________________
no patents on genes, publish the GISAID sequences !


Last edited by gsgs on Wed Nov 04, 2009 6:30 am, edited 1 time in total.

Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sun Nov 01, 2009 3:40 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
grr, editing these posts with long code-windows/tables
is uncomfortale. The edit and reply buttons move outside
the actual window, when you hit the window with the mouse,
the cursor jumps left,...

are there improvements planned (next version...)


how long can I edit posts ?
(in case the theory turns out to be nonsense ;-)

_________________
no patents on genes, publish the GISAID sequences !


Last edited by gsgs on Sun Nov 01, 2009 3:51 am, edited 1 time in total.

Top
 Profile  
 
 Post subject: Re: flu-A evolution
PostPosted: Sun Nov 01, 2009 3:49 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1806
Location: germany
edited 04.Nov, added sequences,segments

differences to the index/birds in PB2,PB1,PA,NP,M1,NS1

Code:
Sti:15,06,19,30,07,08
NL3:02,01,04,03,02,03
H26:19,18,29,15,06,23
Bol:12,23,13,11,03,06
Ros:13,05,14,03,06,11
779:03,04,03,06,02,68
17G:06,17,11,25,03,12
GsG:11,14,17,04,03,71
QiH:12,08,11,07,08,14
H16:03,08,08,04,07,07
Brv:08,07,10,10,04,05
546:05,04,03,04,02,71
Alt:01,01,00,03,02,68


A/red-necked stint/Australia/02/2004(H4N8)
A/Ck/Netherlands/1/2003(H7N7)
A/Ck/Henan/26/2000(H9N2)
A/cinnamon teal/Bolivia/4537/2001(H7N3)
A/fowl/Rostock/1934(H7N1)
A/pintail/Alaska/779/2005(H3N8)
A/Dk/LA/17G/1987(H3N8)
A/Gs/Guangdong/1/1996(H5N1)
A/Gs/Qinghai/62/2005(H5N1)
A/Ck/Henan/16/2004(H5N1)
A/Brevig Mission/1/1918(H1N1)
A/Dk/Memphis/546/1974(H11N9)
A/Dk/Altai/1285(1991(H5N3)

closest would be the 2005-2007 Alaska birds
(Pintails,Shovelers - most H3N8 or H4N6),
the Memphis duck, the Dutch outbreak 2003
the Altai duck,

_________________
no patents on genes, publish the GISAID sequences !


Last edited by gsgs on Wed Nov 04, 2009 6:54 am, edited 1 time in total.

Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 286 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6 ... 29  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 2 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group