Rhiza Labs FluTracker Forum

The place to discuss the flu

Support This Site

 

Old Comment Archive

It is currently Thu Sep 02, 2010 10:29 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 162 posts ]  Go to page 1, 2, 3, 4, 5 ... 17  Next
Author Message
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Aug 22, 2009 7:23 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
LOCUS GQ499337 1410 bp cRNA linear VRL 21-AUG-2009
DEFINITION Influenza A virus (A/Washington/28/2009(H1N1)) segment 6
neuraminidase (NA) gene, complete cds.
ACCESSION GQ499337
VERSION GQ499337.1 GI:256383636
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Washington/28/2009(H1N1))
ORGANISM Influenza A virus (A/Washington/28/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Deyde,V., Sheu,T., Okomo-Adhiambo,M., Hillman,M., Barnes,J.,
Garten,R., Klimov,A., Gubareva,L. and Cox,N.
TITLE Oseltamivir-Resistant Novel Influenza A (H1N1) Virus Infection in
Immunosuppressed Patients Receiving Oseltamivir Therapy
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1410)
AUTHORS Deyde,V., Sheu,T., Okomo-Adhiambo,M., Hillman,M., Barnes,J.,
Garten,R., Klimov,A., Gubareva,L. and Cox,N.
TITLE Direct Submission
JOURNAL Submitted (21-AUG-2009) WHO Collaborating Center for Surveillance,
Epidemiology and Control of Influenza, Influenza Division, Centers
for Disease Control and Prevention, 1600 Clifton Road, N.E.,
Atlanta, GA 30333, USA
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.

Some of the information does not have GenBank feature identifiers
and is being provided in the comment section.

##EpifluData-START##
Isolate A/Washington/28/2009
Subtype H1N1
Segment_name NA
Host_gender M
Host_age 18
Passage_history X
Adamantane_resistance resistant
Zanamivir_resistance sensitive
Oseltamivir_resistance resistant
Country USA
State/Province Washington state
Collection_day 14
Collection_month 7
Collection_year 2009
Isolate_note Human case of H1N1 pandemic influenza with
Oseltamivir Resistance.
EPI_accession EPI191936
Lineage swl
##EpifluData-END##
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/Washington/28/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Washington/28/2009"
/serotype="H1N1"
/host="Homo sapiens; gender: M; age: 18"
/db_xref="taxon:667724"
/segment="6"
/country="USA: Washington state"
/collection_date="14-Jul-2009"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ACU78208.1"
/db_xref="GI:256383637"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSK
DNSVRIGSKGDVFVIREPFISCSPXECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYYY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGS
CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
301 agtaaagaca acagtgtaag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctcccccty ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag taatggacag gcctcataca agatcttcag aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatccg gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Aug 22, 2009 7:24 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
LOCUS GQ499335 1410 bp cRNA linear VRL 21-AUG-2009
DEFINITION Influenza A virus (A/Washington/29/2009(H1N1)) segment 6
neuraminidase (NA) gene, complete cds.
ACCESSION GQ499335
VERSION GQ499335.1 GI:256383632
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Washington/29/2009(H1N1))
ORGANISM Influenza A virus (A/Washington/29/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Deyde,V., Sheu,T., Okomo-Adhiambo,M., Hillman,M., Barnes,J.,
Garten,R., Klimov,A., Gubareva,L. and Cox,N.
TITLE Oseltamivir-Resistant Novel Influenza A (H1N1) Virus Infection in
Immunosuppressed Patients Receiving Oseltamivir Therapy
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1410)
AUTHORS Deyde,V., Sheu,T., Okomo-Adhiambo,M., Hillman,M., Barnes,J.,
Garten,R., Klimov,A., Gubareva,L. and Cox,N.
TITLE Direct Submission
JOURNAL Submitted (21-AUG-2009) WHO Collaborating Center for Surveillance,
Epidemiology and Control of Influenza, Influenza Division, Centers
for Disease Control and Prevention, 1600 Clifton Road, N.E.,
Atlanta, GA 30333, USA
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.

Some of the information does not have GenBank feature identifiers
and is being provided in the comment section.

##EpifluData-START##
Isolate A/Washington/29/2009
Subtype H1N1
Segment_name NA
Host_gender F
Host_age 47
Passage_history X
Adamantane_resistance resistant
Zanamivir_resistance sensitive
Oseltamivir_resistance resistant
Country USA
State/Province Washington state
Collection_day 28
Collection_month 7
Collection_year 2009
Isolate_note Human case of H1N1 pandemic influenza with
Oseltamivir resistance.
EPI_accession EPI191938
Lineage swl
##EpifluData-END##
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/Washington/29/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Washington/29/2009"
/serotype="H1N1"
/host="Homo sapiens; gender: F; age: 47"
/db_xref="taxon:667723"
/segment="6"
/country="USA: Washington state"
/collection_date="28-Jul-2009"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ACU78206.1"
/db_xref="GI:256383633"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVPVKLAGNSSLCPVSGWAIYSK
DNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFXIEKGKIVKSVEMNAPNYYY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGS
CDPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gttcccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
301 agtaaagaca acagtgtaag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag taatggacag gcctcataca agatcttcar aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
901 cgaccgtggg tatctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtgatcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatccg gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Aug 22, 2009 7:27 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Both isolates have a shared polymorphism that produces this travel log

gb|CY044165.1| Influenza A virus (A/Mexico/48N/2009(H1N1)) se... 36.2 0.73
gb|GQ433898.1| Influenza A virus (A/Jiangsu/1/2009(H1N1)) seg... 36.2 0.73
gb|GQ377086.1| Influenza A virus (A/Oregon/07/2009(H1N1)) seg... 36.2 0.73
gb|GQ377074.1| Influenza A virus (A/Washington/18/2009(H1N1))... 36.2 0.73
gb|GQ377048.1| Influenza A virus (A/Washington/17/2009(H1N1))... 36.2 0.73
gb|GQ338393.1| Influenza A virus (A/Washington/08/2009(H1N1))... 36.2 0.73
gb|GQ338371.1| Influenza A virus (A/Washington/10/2009(H1N1))... 36.2 0.73
gb|GQ323562.1| Influenza A virus (A/Florida/10/2009(H1N1)) se... 36.2 0.73
gb|GQ323543.1| Influenza A virus (A/Washington/09/2009(H1N1))... 36.2 0.73
gb|GQ323507.1| Influenza A virus (A/Washington/14/2009(H1N1))... 36.2 0.73
gb|GQ223445.1| Influenza A virus (A/GuangzhouSB/01/2009(H1N1)... 36.2 0.73
gb|GQ221696.1| Influenza A virus (A/GuangzhouSB/01/2009(H1N1)... 36.2 0.73
gb|CY040890.1| Influenza A virus (A/Mexico/47N/2009(H1N1)) se... 36.2 0.73
gb|GQ150333.1| Influenza A virus (A/Christchurch/2/2009(H1N1)... 36.2 0.73
gb|GQ132158.1| Influenza A virus (A/Canada-NS/RV1536/2009(H1N... 36.2 0.73
gb|GQ132154.1| Influenza A virus (A/Canada-NS/RV1538/2009(H1N... 36.2 0.73
gb|GQ122098.1| Influenza A virus (A/Christchurch/2/2009(H1N1)... 36.2 0.73
gb|FJ998213.1| Influenza A virus (A/Canada-NS/RV1535/2009(H1N... 36.2 0.73

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Aug 22, 2009 10:25 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/08220 ... WA_NC.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Aug 22, 2009 11:48 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
SINGAPORE, Aug 22 — Resistance to Tamiflu has been detected in a patient in Singapore who was down with the pandemic Influenza A (H1N1) bug. Similar cases have also emerged in Hong Kong, China, Japan, Canada, the United States and Denmark.

When the novel strain first appeared in April, the antiviral worked well against it. The World Health Organisation (WHO) feels that these instances of it not working are isolated cases of resistance that have developed because Tamiflu had been used at lower, prophylactic doses in people who might have been exposed to the bug.

Because these so-called contacts were, in fact, already infected, the lower doses turned out to be suboptimal, which allowed resistance to emerge. There is no proof that resistance is circulating in the community at large, the WHO asserts.

Yet there is at least one documented case of a 16-year-old girl who fell ill while travelling from San Francisco to Hong Kong on June 11. Though she declined Tamiflu, an isolate from her was found to carry the H274Y mutation, which signals Tamiflu-resistance.

She was, however, not the world’s first case of such resistance, an honour belonging to a woman seen in Denmark in late June. When she got home from Britain, she was given Tamiflu prophylaxis. Yet she still fell ill on the fifth day of taking Tamiflu. H274Y was detected in her isolate.

Could she have been infected in Britain by someone carrying mainly Tamiflu-sensitive bugs but also a small population of resistant bugs? In that case, suboptimal Tamiflu dosage might have suppressed enough of the sensitive bugs to prevent any clinical symptoms. Over the five days, however, the resistant bugs could have replicated enough to predominate and thus cause clinical illness.

But if this is so, then the mutation must already have been circulating in Britain — which, however, has not reported any cases of Tamiflu resistance yet. Alternatively, she might have caught the resistant bug in Denmark itself, during the five days when she was well and ambulant.

One reason for suspecting community circulation of the resistant bug is that 98 per cent of all seasonal H1N1 bugs now carry H274Y. If patients are infected with both strains, that mutation could jump from seasonal flu to pandemic flu. But the WHO insists there is no evidence this has occurred, so all resistant cases must have emerged because of suboptimal Tamiflu dosages.

There are signs of community circulation in the US, at least. First, the genomics of the Hong Kong isolate where no Tamiflu was used suggests that the infection originated in the US.

Second, it was revealed only this month that a May 30 isolate taken from a young American woman returning to Singapore from Honolulu carried H274Y.

Flying on May 26, she fell ill on board the plane, was hospitalised here on May 27, was confirmed to be a H1N1 case on May 28, but was discharged on May 31 feeling well.

Although her May 28 sample was Tamiflu-sensitive, her May 30 sample had H274Y. Two days is probably too short an interval for resistance to develop from any suboptimal dosages of Tamiflu. At any rate, as a confirmed case, she would have been given the full dosage.

Thus it is entirely possible that she was infected in the US with both the sensitive and resistant strains, which her immune defences could have cleared quickly, so she was discharged fairly quickly.

Third, on Aug 15, the US authorities sent out an urgent report to physicians that two intensive care patients in Washington state who had been infected last month and treated aggressively with Tamiflu were found to have bugs with H274Y.

These four cases suggest that H274Y may already be circulating in the US. It is possible we are seeing relatively few of these isolates for a technical reason: All published genomes are consensus sequences of DNA. That is, the base that is considered to occupy a specific position on the genome is the one that occurs most frequently. But it needs do so 100 per cent of the time.

If a base occurs in only 10 per cent of viral particles, it isn’t likely to show up in the published sequence. It is only when a base occurs in, say, half the cases that it might appear in the consensus sequence.

If H274Y were found in, say, 10 per cent of viral particles, it won’t appear in the consensus sequence of samples taken from a patient prior to Tamiflu being used. Once Tamiflu is employed, the population of sensitive bugs would be drastically reduced. However, those with H274Y would flourish.

Thus, although it was already around prior to Tamiflu being used, the resistant bug would not be detected. After the drug is employed, however, the resistant bugs can grow to greater numbers than the sensitive ones, rendering them detectable.

Of course, if more samples are taken before Tamiflu is used, H274Y might be detected more often. Such comprehensive surveillance, however, would consume too much resources.

History suggests it was limited testing that enabled Tamiflu-resistance in seasonal Influenza A (H1N1) to creep up on the world unawares. The first instance of that was detected in Norway in spring last year.

By the 2008/2009 season, however, it was found in 98 per cent of bugs worldwide. Yet a re-testing of old samples showed that H274Y was already widespread by the autumn of 2007. This means it was circulating in the community before it was first detected in Norway last year.

Is history repeating itself? If so, Singapore should be stocking up on Relenza, the other antiviral that still works. — Straits Times

http://www.themalaysianinsider.com/inde ... -singapore

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Mon Aug 24, 2009 3:41 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Updated list fro A1231G:

gb|GQ499337.1| Influenza A virus (A/Washington/28/2009(H1N1))... 40.1 0.047
gb|GQ499335.1| Influenza A virus (A/Washington/29/2009(H1N1))... 40.1 0.047
gb|GQ465707.1| Influenza A virus (A/Canada-NS/RV1565/2009(H1N... 40.1 0.047
gb|GQ465699.1| Influenza A virus (A/Canada-NS/RV1554/2009(H1N... 40.1 0.047
gb|GQ465698.1| Influenza A virus (A/Canada-NS/RV1551/2009(H1N... 40.1 0.047
gb|CY044165.1| Influenza A virus (A/Mexico/48N/2009(H1N1)) se... 40.1 0.047
gb|GQ433898.1| Influenza A virus (A/Jiangsu/1/2009(H1N1)) seg... 40.1 0.047
gb|GQ377086.1| Influenza A virus (A/Oregon/07/2009(H1N1)) seg... 40.1 0.047
gb|GQ377074.1| Influenza A virus (A/Washington/18/2009(H1N1))... 40.1 0.047
gb|GQ377048.1| Influenza A virus (A/Washington/17/2009(H1N1))... 40.1 0.047
gb|GQ338393.1| Influenza A virus (A/Washington/08/2009(H1N1))... 40.1 0.047
gb|GQ338371.1| Influenza A virus (A/Washington/10/2009(H1N1))... 40.1 0.047
gb|GQ323562.1| Influenza A virus (A/Florida/10/2009(H1N1)) se... 40.1 0.047
gb|GQ323543.1| Influenza A virus (A/Washington/09/2009(H1N1))... 40.1 0.047
gb|GQ323507.1| Influenza A virus (A/Washington/14/2009(H1N1))... 40.1 0.047
gb|GQ223445.1| Influenza A virus (A/GuangzhouSB/01/2009(H1N1)... 40.1 0.047
gb|GQ221696.1| Influenza A virus (A/GuangzhouSB/01/2009(H1N1)... 40.1 0.047
gb|CY040890.1| Influenza A virus (A/Mexico/47N/2009(H1N1)) se... 40.1 0.047
gb|GQ150333.1| Influenza A virus (A/Christchurch/2/2009(H1N1)... 40.1 0.047
gb|GQ132158.1| Influenza A virus (A/Canada-NS/RV1536/2009(H1N... 40.1 0.047
gb|GQ132154.1| Influenza A virus (A/Canada-NS/RV1538/2009(H1N... 40.1 0.047
gb|GQ122098.1| Influenza A virus (A/Christchurch/2/2009(H1N1)... 40.1 0.047

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Mon Aug 24, 2009 6:25 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/08240 ... Match.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Mon Aug 24, 2009 11:18 am 
Offline
User avatar

Joined: Tue Aug 11, 2009 2:58 pm
Posts: 1325
Location: Katy, TX
Taiwan:

http://english.rti.org.tw/Content/GetSingleNews.aspx?ContentID=85237

The rapid progression of her illness despite the administration of anti-viral medication raises fears that she might have a strain of H1N1 that has developed some resistance to the medication. CDC Director Steve Kuo explains.

"This is why we have to have a special investigation of this death," said Kuo, "we need to retrace the steps that lead up to the fatality to figure out whether the drug was given too slowly or whether the virus was able to resist the medication."

_________________
I am not a doctor, virologist, or any of type of medical/life sciences professional.

I am a layman with a background in the physical sciences.


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Thu Aug 27, 2009 10:44 pm 
Offline
User avatar

Joined: Tue Aug 11, 2009 2:58 pm
Posts: 1325
Location: Katy, TX
I think this is new. Tamiflu resistance confirmed in California?
http://www.cdph.ca.gov/programs/vrdl/Documents/InfluenzaUpdate082009.pdf

Quote:
During this week, the CDPH Viral and Rickettsial Diseases Laboratory detected a specimen with the H275Y resistance mutation (associated with oseltamivir resistance); the result was confirmed by the CDC. This is the first time that this mutation has been detected by the VRDL and provides strong evidence for the importance of enhanced surveillance for antiviral resistance testing. The specimen was obtained from a hospitalized patient in Northern California. To date, 308 specimens have been tested at VRDL for the resistance mutation; all but one have tested negative for the mutation. VRDL and CDC will continue prospective antiviral resistance testing from a sampling of pandemic (H1N1) 2009 influenza viruses through the summer and the 2009-10 influenza season.

_________________
I am not a doctor, virologist, or any of type of medical/life sciences professional.

I am a layman with a background in the physical sciences.


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Fri Aug 28, 2009 4:22 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
wotan wrote:
I think this is new. Tamiflu resistance confirmed in California?
http://www.cdph.ca.gov/programs/vrdl/Documents/InfluenzaUpdate082009.pdf

Quote:
During this week, the CDPH Viral and Rickettsial Diseases Laboratory detected a specimen with the H275Y resistance mutation (associated with oseltamivir resistance); the result was confirmed by the CDC. This is the first time that this mutation has been detected by the VRDL and provides strong evidence for the importance of enhanced surveillance for antiviral resistance testing. The specimen was obtained from a hospitalized patient in Northern California. To date, 308 specimens have been tested at VRDL for the resistance mutation; all but one have tested negative for the mutation. VRDL and CDC will continue prospective antiviral resistance testing from a sampling of pandemic (H1N1) 2009 influenza viruses through the summer and the 2009-10 influenza season.

Yes, this is new and of course northern California (San Francisco) is the origin of the case in Hong Kong where the traveler had a mild case and recivered with no Tamiflu resitance. It is not clear if this is the first hospitalized patient in the US who is not immunocompromised, since the above doesn't give details on the patient.

The UK is also listing a summary of WHO notified cases, and they show 4 from Japan, which is an increase of one over the cases I know of.

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 162 posts ]  Go to page 1, 2, 3, 4, 5 ... 17  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 1 guest


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group