Rhiza Labs FluTracker Forum

The place to discuss the flu

Support This Site

 

Old Comment Archive

It is currently Thu Sep 02, 2010 10:34 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 162 posts ]  Go to page Previous  1 ... 13, 14, 15, 16, 17  Next
Author Message
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 15, 2009 11:30 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
HA travel log

dbj|AB536769.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 40.1 0.049
dbj|AB535742.1| Influenza A virus (A/Nagasaki/HA-48/2009(H1N1... 40.1 0.049
****************************

dbj|AB536769.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 36.2 0.76
dbj|AB535747.1| Influenza A virus (A/Nagasaki/HA-60/2009(H1N1... 36.2 0.76
dbj|AB535742.1| Influenza A virus (A/Nagasaki/HA-48/2009(H1N1... 36.2 0.76
dbj|AB535740.1| Influenza A virus (A/Nagasaki/HA-37/2009(H1N1... 36.2 0.76
dbj|AB535739.1| Influenza A virus (A/Nagasaki/HA-30/2009(H1N1... 36.2 0.76
dbj|AB535738.1| Influenza A virus (A/Nagasaki/HA-24/2009(H1N1... 36.2 0.76
dbj|AB530487.1| Influenza A virus (A/Nagasaki/HA-42/2009(H1N1... 36.2 0.76
dbj|AB530486.1| Influenza A virus (A/Nagasaki/HA-41/2009(H1N1... 36.2 0.76
dbj|AB530485.1| Influenza A virus (A/Nagasaki/HA-40/2009(H1N1... 36.2 0.76
dbj|AB530484.1| Influenza A virus (A/Nagasaki/HA-39/2009(H1N1... 36.2 0.76
dbj|AB530483.1| Influenza A virus (A/Nagasaki/HA-38/2009(H1N1... 36.2 0.76
dbj|AB530482.1| Influenza A virus (A/Nagasaki/HA-36/2009(H1N1... 36.2 0.76
dbj|AB530481.1| Influenza A virus (A/Nagasaki/HA-35/2009(H1N1... 36.2 0.76
dbj|AB530480.1| Influenza A virus (A/Nagasaki/HA-34/2009(H1N1... 36.2 0.76
dbj|AB530479.1| Influenza A virus (A/Nagasaki/HA-33/2009(H1N1... 36.2 0.76
dbj|AB530478.1| Influenza A virus (A/Nagasaki/HA-32/2009(H1N1... 36.2 0.76
dbj|AB530477.1| Influenza A virus (A/Nagasaki/HA-31/2009(H1N1... 36.2 0.76
dbj|AB530476.1| Influenza A virus (A/Nagasaki/HA-29/2009(H1N1... 36.2 0.76
dbj|AB530475.1| Influenza A virus (A/Nagasaki/HA-28/2009(H1N1... 36.2 0.76
dbj|AB530474.1| Influenza A virus (A/Nagasaki/HA-27/2009(H1N1... 36.2 0.76
dbj|AB530473.1| Influenza A virus (A/Nagasaki/HA-26/2009(H1N1... 36.2 0.76
dbj|AB530471.1| Influenza A virus (A/Nagasaki/HA-22/2009(H1N1... 36.2 0.76
dbj|AB530470.1| Influenza A virus (A/Nagasaki/HA-18/2009(H1N1... 36.2 0.76
dbj|AB530468.1| Influenza A virus (A/Nagasaki/HA-16/2009(H1N1... 36.2 0.76
dbj|AB530467.1| Influenza A virus (A/Nagasaki/HA-15/2009(H1N1... 36.2 0.76
dbj|AB530466.1| Influenza A virus (A/Nagasaki/HA-14/2009(H1N1... 36.2 0.76
dbj|AB530465.1| Influenza A virus (A/Nagasaki/HA-13/2009(H1N1... 36.2 0.76
dbj|AB530464.1| Influenza A virus (A/Nagasaki/HA-12/2009(H1N1... 36.2 0.76
dbj|AB530463.1| Influenza A virus (A/Nagasaki/HA-11/2009(H1N1... 36.2 0.76
gb|GU117765.1| Influenza A virus (A/Nagasaki/I01/2009(H1N1)) ... 36.2 0.76
*****************

dbj|AB536769.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 38.2 0.19
dbj|AB535747.1| Influenza A virus (A/Nagasaki/HA-60/2009(H1N1... 38.2 0.19
dbj|AB535742.1| Influenza A virus (A/Nagasaki/HA-48/2009(H1N1... 38.2 0.19
dbj|AB535740.1| Influenza A virus (A/Nagasaki/HA-37/2009(H1N1... 38.2 0.19
dbj|AB535739.1| Influenza A virus (A/Nagasaki/HA-30/2009(H1N1... 38.2 0.19
dbj|AB535738.1| Influenza A virus (A/Nagasaki/HA-24/2009(H1N1... 38.2 0.19
dbj|AB530487.1| Influenza A virus (A/Nagasaki/HA-42/2009(H1N1... 38.2 0.19
dbj|AB530486.1| Influenza A virus (A/Nagasaki/HA-41/2009(H1N1... 38.2 0.19
dbj|AB530485.1| Influenza A virus (A/Nagasaki/HA-40/2009(H1N1... 38.2 0.19
dbj|AB530484.1| Influenza A virus (A/Nagasaki/HA-39/2009(H1N1... 38.2 0.19
dbj|AB530483.1| Influenza A virus (A/Nagasaki/HA-38/2009(H1N1... 38.2 0.19
dbj|AB530482.1| Influenza A virus (A/Nagasaki/HA-36/2009(H1N1... 38.2 0.19
dbj|AB530481.1| Influenza A virus (A/Nagasaki/HA-35/2009(H1N1... 38.2 0.19
dbj|AB530480.1| Influenza A virus (A/Nagasaki/HA-34/2009(H1N1... 38.2 0.19
dbj|AB530479.1| Influenza A virus (A/Nagasaki/HA-33/2009(H1N1... 38.2 0.19
dbj|AB530478.1| Influenza A virus (A/Nagasaki/HA-32/2009(H1N1... 38.2 0.19
dbj|AB530477.1| Influenza A virus (A/Nagasaki/HA-31/2009(H1N1... 38.2 0.19
dbj|AB530475.1| Influenza A virus (A/Nagasaki/HA-28/2009(H1N1... 38.2 0.19
dbj|AB530474.1| Influenza A virus (A/Nagasaki/HA-27/2009(H1N1... 38.2 0.19
dbj|AB530472.1| Influenza A virus (A/Nagasaki/HA-25/2009(H1N1... 38.2 0.19
dbj|AB530471.1| Influenza A virus (A/Nagasaki/HA-22/2009(H1N1... 38.2 0.19
dbj|AB530470.1| Influenza A virus (A/Nagasaki/HA-18/2009(H1N1... 38.2 0.19
dbj|AB530469.1| Influenza A virus (A/Nagasaki/HA-17/2009(H1N1... 38.2 0.19
dbj|AB530468.1| Influenza A virus (A/Nagasaki/HA-16/2009(H1N1... 38.2 0.19
dbj|AB530467.1| Influenza A virus (A/Nagasaki/HA-15/2009(H1N1... 38.2 0.19
dbj|AB530466.1| Influenza A virus (A/Nagasaki/HA-14/2009(H1N1... 38.2 0.19
dbj|AB530465.1| Influenza A virus (A/Nagasaki/HA-13/2009(H1N1... 38.2 0.19
dbj|AB530464.1| Influenza A virus (A/Nagasaki/HA-12/2009(H1N1... 38.2 0.19
dbj|AB530463.1| Influenza A virus (A/Nagasaki/HA-11/2009(H1N1... 38.2 0.19
dbj|AB530462.1| Influenza A virus (A/Nagasaki/HA-10/2009(H1N1... 38.2 0.19
gb|GU117765.1| Influenza A virus (A/Nagasaki/I01/2009(H1N1)) ... 38.2 0.19
***************************

gb|CY053373.1| Influenza A virus (A/Catalonia/S1935/2009(H1N1... 42.1 0.018
gb|CY052266.1| Influenza A virus (A/Texas/42102708/2009(H1N1)... 42.1 0.018
gb|CY052146.1| Influenza A virus (A/New York/4398/2009(H1N1))... 42.1 0.018
gb|CY052839.1| Influenza A virus (A/Texas/45132202/2009(H1N1)... 42.1 0.018
gb|CY052743.1| Influenza A virus (A/Texas/45101424/2009(H1N1)... 42.1 0.018
gb|CY052695.1| Influenza A virus (A/Texas/45083819/2009(H1N1)... 42.1 0.018
gb|CY052615.1| Influenza A virus (A/Texas/44302533/2009(H1N1)... 42.1 0.018
gb|CY052551.1| Influenza A virus (A/Texas/45122774/2009(H1N1)... 42.1 0.018
gb|CY052503.1| Influenza A virus (A/Texas/45104026/2009(H1N1)... 42.1 0.018
gb|CY052366.1| Influenza A virus (A/Zavkhan/8299/2009(H1N1)) ... 42.1 0.018
dbj|AB536770.1| Influenza A virus (A/Nagasaki/HA-62/2009(H1N1... 42.1 0.018
dbj|AB536769.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 42.1 0.018
dbj|AB535747.1| Influenza A virus (A/Nagasaki/HA-60/2009(H1N1... 42.1 0.018
dbj|AB535743.1| Influenza A virus (A/Nagasaki/HA-50/2009(H1N1... 42.1 0.018
dbj|AB535742.1| Influenza A virus (A/Nagasaki/HA-48/2009(H1N1... 42.1 0.018
dbj|AB535741.1| Influenza A virus (A/Nagasaki/NU-2/2009(H1N1)... 42.1 0.018
dbj|AB535740.1| Influenza A virus (A/Nagasaki/HA-37/2009(H1N1... 42.1 0.018
dbj|AB535739.1| Influenza A virus (A/Nagasaki/HA-30/2009(H1N1... 42.1 0.018
dbj|AB535738.1| Influenza A virus (A/Nagasaki/HA-24/2009(H1N1... 42.1 0.018
gb|CY052030.1| Influenza A virus (A/Catalonia/S1827/2009(H1N1... 42.1 0.018
gb|CY052026.1| Influenza A virus (A/Catalonia/NS7362/2009(H1N... 42.1 0.018
gb|CY052014.1| Influenza A virus (A/Norway/4021/2009(H1N1)) s... 42.1 0.018
gb|CY052013.1| Influenza A virus (A/Norway/4020/2009(H1N1)) s... 42.1 0.018
gb|CY052012.1| Influenza A virus (A/Norway/3855/2009(H1N1)) s... 42.1 0.018
gb|CY052006.1| Influenza A virus (A/Norway/3440/2009(H1N1)) s... 42.1 0.018
gb|CY052004.1| Influenza A virus (A/Norway/3371/2009(H1N1)) s... 42.1 0.018
gb|CY052003.1| Influenza A virus (A/Norway/3370/2009(H1N1)) s... 42.1 0.018
gb|CY051998.1| Influenza A virus (A/Norway/3364-2/2009(H1N1))... 42.1 0.018
gb|CY051994.1| Influenza A virus (A/Norway/3278/2009(H1N1)) s... 42.1 0.018
gb|CY051989.1| Influenza A virus (A/Norway/2924/2009(H1N1)) s... 42.1 0.018
gb|CY051982.1| Influenza A virus (A/Catalonia/S1761/2009(H1N1... 42.1 0.018
gb|CY051967.1| Influenza A virus (A/Catalonia/S1751/2009(H1N1... 42.1 0.018
gb|CY051964.1| Influenza A virus (A/Catalonia/S1748/2009(H1N1... 42.1 0.018
gb|CY051949.1| Influenza A virus (A/Catalonia/S1687/2009(H1N1... 42.1 0.018
gb|GU211235.1| Influenza A virus (A/Omsk/02/2009(H1N1)) segme... 42.1 0.018
gb|CY050846.1| Influenza A virus (A/Ulaanbaatar/6133/2009(H1N... 42.1 0.018
gb|CY050845.1| Influenza A virus (A/Ulaanbaatar/6266/2009(H1N... 42.1 0.018
gb|CY051807.1| Influenza A virus (A/New York/4870/2009(H1N1))... 42.1 0.018
gb|CY051783.1| Influenza A virus (A/New York/4844/2009(H1N1))... 42.1 0.018
gb|CY049963.1| Influenza A virus (A/Santo Domingo/WR1059N/200... 42.1 0.018
gb|CY049955.1| Influenza A virus (A/Santo Domingo/WR1058N/200... 42.1 0.018
gb|CY049947.1| Influenza A virus (A/Santo Domingo/WR1057N/200... 42.1 0.018
gb|CY049571.1| Influenza A virus (A/Singapore/ON1156/2009(H1N... 42.1 0.018
gb|CY049068.1| Influenza A virus (A/Singapore/ON129/2009(H1N1... 42.1 0.018
dbj|AB530489.1| Influenza A virus (A/Nagasaki/NU-1/2009(H1N1)... 42.1 0.018
dbj|AB530487.1| Influenza A virus (A/Nagasaki/HA-42/2009(H1N1... 42.1 0.018
dbj|AB530486.1| Influenza A virus (A/Nagasaki/HA-41/2009(H1N1... 42.1 0.018
dbj|AB530485.1| Influenza A virus (A/Nagasaki/HA-40/2009(H1N1... 42.1 0.018
dbj|AB530484.1| Influenza A virus (A/Nagasaki/HA-39/2009(H1N1... 42.1 0.018
dbj|AB530483.1| Influenza A virus (A/Nagasaki/HA-38/2009(H1N1... 42.1 0.018
dbj|AB530482.1| Influenza A virus (A/Nagasaki/HA-36/2009(H1N1... 42.1 0.018
dbj|AB530481.1| Influenza A virus (A/Nagasaki/HA-35/2009(H1N1... 42.1 0.018
dbj|AB530480.1| Influenza A virus (A/Nagasaki/HA-34/2009(H1N1... 42.1 0.018
dbj|AB530479.1| Influenza A virus (A/Nagasaki/HA-33/2009(H1N1... 42.1 0.018
dbj|AB530478.1| Influenza A virus (A/Nagasaki/HA-32/2009(H1N1... 42.1 0.018
dbj|AB530477.1| Influenza A virus (A/Nagasaki/HA-31/2009(H1N1... 42.1 0.018
dbj|AB530476.1| Influenza A virus (A/Nagasaki/HA-29/2009(H1N1... 42.1 0.018
dbj|AB530475.1| Influenza A virus (A/Nagasaki/HA-28/2009(H1N1... 42.1 0.018
dbj|AB530474.1| Influenza A virus (A/Nagasaki/HA-27/2009(H1N1... 42.1 0.018
dbj|AB530473.1| Influenza A virus (A/Nagasaki/HA-26/2009(H1N1... 42.1 0.018
dbj|AB530472.1| Influenza A virus (A/Nagasaki/HA-25/2009(H1N1... 42.1 0.018
dbj|AB530471.1| Influenza A virus (A/Nagasaki/HA-22/2009(H1N1... 42.1 0.018
dbj|AB530470.1| Influenza A virus (A/Nagasaki/HA-18/2009(H1N1... 42.1 0.018
dbj|AB530469.1| Influenza A virus (A/Nagasaki/HA-17/2009(H1N1... 42.1 0.018
dbj|AB530468.1| Influenza A virus (A/Nagasaki/HA-16/2009(H1N1... 42.1 0.018
dbj|AB530466.1| Influenza A virus (A/Nagasaki/HA-14/2009(H1N1... 42.1 0.018
dbj|AB530465.1| Influenza A virus (A/Nagasaki/HA-13/2009(H1N1... 42.1 0.018
dbj|AB530464.1| Influenza A virus (A/Nagasaki/HA-12/2009(H1N1... 42.1 0.018
dbj|AB530463.1| Influenza A virus (A/Nagasaki/HA-11/2009(H1N1... 42.1 0.018
dbj|AB530462.1| Influenza A virus (A/Nagasaki/HA-10/2009(H1N1... 42.1 0.018
gb|CY049713.1| Influenza A virus (A/Catalonia/S1501/2009(H1N1... 42.1 0.018
gb|CY049039.1| Influenza A virus (A/Catalonia/S1402/2009(H1N1... 42.1 0.018
gb|GU117765.1| Influenza A virus (A/Nagasaki/I01/2009(H1N1)) ... 42.1 0.018
gb|CY047275.1| Influenza A virus (A/Catalonia/S1268/2009(H1N1... 42.1 0.018
gb|CY047272.1| Influenza A virus (A/Catalonia/S1267/2009(H1N1... 42.1 0.018
gb|CY047179.1| Influenza A virus (A/Catalonia/S1181/2009(H1N1... 42.1 0.018
gb|CY047176.1| Influenza A virus (A/Catalonia/S1179/2009(H1N1... 42.1 0.018
gb|CY047161.1| Influenza A virus (A/Catalonia/S1162/2009(H1N1... 42.1 0.018
gb|CY047118.1| Influenza A virus (A/Catalonia/S1096/2009(H1N1... 42.1 0.018
gb|GU014750.1| Influenza A virus (A/Hiroshima/201/2009(H1N1))... 42.1 0.018
gb|GQ894911.1| Influenza A virus (A/Oregon/20/2009(H1N1)) seg... 42.1 0.018
gb|GQ894830.1| Influenza A virus (A/Rhode Island/08/2009(H1N1... 42.1 0.018
gb|CY046065.1| Influenza A virus (A/Italy/132/2009(H1N1)) seg... 42.1 0.018
gb|CY046062.1| Influenza A virus (A/Italy/129/2009(H1N1)) seg... 42.1 0.018
gb|GQ527165.1| Influenza A virus (A/Singapore/TLL51/2009(H1N1... 42.1 0.018
gb|CY044997.1| Influenza A virus (A/New York/3828/2009(H1N1))... 42.1 0.018
gb|CY044080.1| Influenza A virus (A/New York/3715/2009(H1N1))... 42.1 0.018
gb|CY044072.1| Influenza A virus (A/New York/3702/2009(H1N1))... 42.1 0.018
gb|GQ414768.1| Influenza A virus (A/Sao Paulo/43812/2009(H1N1... 42.1 0.018
gb|GQ377095.1| Influenza A virus (A/California/24/2009(H1N1))... 42.1 0.018
gb|GQ359765.1| Influenza A virus (A/Stockholm/31/2009(H1N1)) ... 42.1 0.018
gb|GQ292961.1| Influenza A virus (A/Mexico City/22/2009(H1N1)... 42.1 0.018
gb|GQ232085.1| Influenza A virus (A/Guangdong/02/2009(H1N1)) ... 42.1 0.018
gb|GQ223435.1| Influenza A virus (A/Guangdong/05/2009(H1N1)) ... 42.1 0.018
gb|GQ132144.1| Influenza A virus (A/Canada-ON/RV1529/2009(H1N... 42.1 0.018

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 15, 2009 11:36 pm 
Offline
User avatar

Joined: Sun Nov 22, 2009 2:40 am
Posts: 575
The EU reports 1% like the CDC...

"Oseltamivir resistance was found in one percent of influenza pandemic viruses tested in the countries reporting to EISN"
http://ecdc.europa.eu/en/healthtopics/D ... 900hrs.pdf

_________________
If your leaders tell you the Kingdom is in the heavens, the birds will get there before you.
If they say it's beneath the ground, the fish will get there before you.
It is within you and outside you..P.Oxy 654


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Wed Dec 16, 2009 11:06 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
EU spin machine in action:

By week 50 in the Netherlands, 11 patients were diagnosed with a mixture of oseltamivir resistant and wild-type A(H1N1)v influenza viruses in one respiratory specimen during oseltamivir therapy, indicating resistance emerged during therapy and not by infection with a resistant virus. Nine of the patients were immunosuppressed due to chemotherapy/immunosuppressive therapy, of which four died. Contact tracing identified no cases of onward transmission of the oseltamivir-resistant viruses.

http://www.ecdc.europa.eu/en/activities ... erview.pdf

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Wed Dec 16, 2009 11:24 am 
Offline
User avatar

Joined: Wed Oct 28, 2009 3:28 am
Posts: 585
Location: Netherlands
What's immunosuppressive therapy ?
I already know, sorry

_________________
http://mexicaansegriep.uwstart.nl | http://twitter.com/H1N1Nederland


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Wed Dec 16, 2009 2:01 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/12160 ... SS_TX.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Thu Dec 17, 2009 3:30 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
LOCUS CY053412 420 bp cRNA linear VRL 16-DEC-2009
DEFINITION Influenza A virus (A/UAE/A01/2009(H1N1)) segment 6 sequence.
ACCESSION CY053412
VERSION CY053412.1 GI:281312491
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/UAE/A01/2009(H1N1))
ORGANISM Influenza A virus (A/UAE/A01/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 420)
AUTHORS Alfaresi,M.S., Albedwawi,S.S. and Hag-Ali,M.
TITLE Pandemic Influenza A (H1N1) 2009 viruses circulating in the UAE
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 420)
AUTHORS Alfaresi,M.S., Albedwawi,S.S. and Hag-Ali,M.
TITLE Direct Submission
JOURNAL Submitted (16-DEC-2009) Department of Pathology & Laboratory
Medicine, Zayed Military Hospital, PO BOX 3740, Abudhabi, United
Arab Emirates
FEATURES Location/Qualifiers
source 1..420
/organism="Influenza A virus (A/UAE/A01/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/UAE/A01/2009(H1N1)"
/serotype="H1N1"
/isolation_source="gender:M; age:12; Nasal swab"
/host="human"
/db_xref="taxon:700915"
/segment="6"
/country="United Arab Emirates: Abudhabi"
/collection_date="22-Oct-2009"
/note="H274Y mutation"
gene <1..>420
/gene="NA"
CDS <1..>420
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ADA59218.1"
/db_xref="GI:281312492"
/translation="KSVEMNAPNYYYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQ
NLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSIS
SRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSG"
ORIGIN
1 aaatcagtcg aaatgaatgc ccctaattat tactatgagg aatgctcctg ttatcctgat
61 tctagtgaaa tcacatgtgt gtgcagggat aactggcatg gctcgaatcg accgtgggtg
121 tctttcaacc agaatctgga atatcagata ggatacatat gcagtgggat tttcggagac
181 aatccacgcc ctaatgataa gacaggcagt tgtggtccag tatcgtctaa tggagcaaat
241 ggagtaaaag gattttcatt caaatacggc aatggtgttt ggatagggag aactaaaagc
301 attagttcaa gaaacggttt tgagatgatt tgggatccga acggatggac tgggacagac
361 aataacttct caataaagca agatatcgta ggaataaatg agtggtcagg atatagcggg

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 22, 2009 9:34 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
INFLUENZA PANDEMIC (H1N1) 2009 (74): CANADA (ONTARIO) OSELTAMIVIR RESISTANCE
***************************************************************************
A ProMED-mail post
<http://www.promedmail.org>
ProMED-mail is a program of the
International Society for Infectious Diseases
<http://www.isid.org>

Date: Thu 22 Oct 2009
From: Jonathan Gubbay <jonathan.gubbay@oahpp.ca> [edited]


Ontario Public Health Laboratory (OPHL), Ontario Agency for Health
Protection and Promotion (OAHPP) performs molecular testing for
pandemic (H1N1) 2009 (pH1N1) for the province of Ontario, Canada. In
addition, surveillance for antiviral resistance using the CDC
pyrosequencing assay is done on a selection of samples, with over 300
pH1N1 samples tested at OPHL since the onset of the pandemic(1).

On 9 Aug 2009 influenza A was detected at a referring hospital in a
nasopharyngeal (NP) swab collected from a young adult in his 20s with
an underlying hematological malignancy; the sample was forwarded to
OPHL for subtyping and identified as pH1N1 by real-time reverse
transcriptase PCR (rRT-PCR).

The patient was commenced on oseltamivir on 9 Aug 2009, and received
treatment dose (75 mg twice daily orally) intermittently from 10-20
Aug, 25-26 Aug, 16 Aug-18 Sep, and 25-27 Sep 2009. Influenza A was
detected on repeat NP swabs tested at the local hospital on 17 and 24
Aug, and 1 and 7 Sep 2009.

The 7 Sep 2009 influenza A positive NP swab collected after 24 days
of intermittent therapy was forwarded to OPHL, which was subtyped as
pH1N1 by rRT-PCR. In early October, as part of the Ontario's
surveillance project for antiviral resistance, the sample was tested
by pyrosequencing for oseltamivir resistance, and was found to
contain the H275Y mutation (histidine to tyrosine; H274Y in N2
numbering) conferring oseltamivir resistance. This mutation was
confirmed with Sanger sequencing at OPHL and at Canada's National
Microbiology Laboratory (NML). The original sample collected on 9 Aug
2009 was also tested for oseltamivir resistance with no evidence of
the H275Y mutation. Phenotypic neuraminidase inhibitor resistance
testing is being conducted at NML.

The patient improved clinically and was discharged home one day
following the collection of the NP swab containing the resistant
isolate. Subsequent NP swabs on 9 and 24 Sep 2009 were negative for
influenza A. Unfortunately, he required readmission to the hospital a
few weeks following the discharge due to overwhelming Epstein Barr
virus infection and subsequently died. The NP swab performing during
the 2nd admission (24 Sep 2009) was negative for influenza A by DFA
[direct fluorescent antibody] and PCR.

To our knowledge, this represents Canada's 3rd case of oseltamivir
resistant pH1N1, with Quebec and Alberta documenting one case
each(2,3). As has been previously documented, immunocompromised
patients are at risk of prolonged viral shedding with pH1N1, and
prolonged therapy with oseltamivir predisposes them to develop
infection due to neuraminidase resistant virus during the course of
therapy(4). Resistance should also be considered in patients who
develop pH1N1 infection while on oseltamivir prophylaxis, as has been
recently documented(2,5,6).

Oseltamivir resistance remains very rare, with 35 episodes reported
by the World Health Organization (WHO) as of 16 Oct 2009(6). [The
case in Taiwan reported in the preceding ProMED-mail post entitled
'Influenza pandemic (H1N1) 2009 (73): Taiwan oseltamivir resistance
20091021.3626' will have become the 36th case. - Mod.CP]

Although its prevalence is very low to warrant any change in empiric
antiviral therapy for pH1N1 infection, it is important to continue
with the surveillance for antiviral resistance as it is possible that
resistance to oseltamivir may evolve over time. Resistance testing
also has an important clinical role in patients who are persistently
shedding the virus and not clinically improving despite treatment and
for those who develop pH1N1 infection while receiving oseltamivir prophylaxis.

References
----------
1. World Health Organization: CDC pyrosequencing assay to detect
H275Y mutation in the neuraminidase of novel A (H1N1) viruses. Available at
<http://www.who.int/csr/resources/publications/swineflu/NA_DetailedPyrosequencing_20090513.pdf>.
2. ProMED-mail. Archive Number 20090722.2597: Oseltamivir resistance.
22 Jul 2009.
3. ProMED-mail. Archive Number 20090917.3260: Influenza pandemic
(H1N1) 2009 (50): oseltamivir resistance. 17 Sep 2009.
4. MMWR: Oseltamivir-Resistant Novel Influenza A (H1N1) Virus
Infection in Two Immunosuppressed Patients - Seattle, Washington,
2009. August 14, 2009 / 58 (Dispatch); 1-4. Available at
<http://www.cdc.gov/mmwr/preview/mmwrhtml/mm5832a3.htm>.
5. MMWR: Oseltamivir-Resistant 2009 Pandemic Influenza A (H1N1) Virus
Infection in Two Summer Campers Receiving Prophylaxis - North
Carolina, 2009. September 11, 2009 / 58(35); 969-72. Available at
<http://www.cdc.gov/mmwr/preview/mmwrhtml/mm5835a1.htm>.
6. WHO Pandemic (H1N1) 2009 - update 70. Weekly update (Virological
surveillance data). Available at
<http://www.who.int/csr/disease/swineflu/laboratory16_10_2009/en/index.html>.

[R Eshaghi1, C Mackie2, AL Winter3, C Lee4, Y Li5, N Bastien5, DE
Low1, and JB Gubbay1
1. Public Health Laboratory, Ontario Agency for Health Protection and
Promotion (OAHPP), Canada
2. Health Protection Division, Hamilton Public Health Services, Ontario, Canada
3. Ontario Ministry of Health and Long-Term Care
4. Medical Microbiology, St Joseph's Healthcare, Hamilton, Ontario, Canada
5. Influenza and Respiratory Viruses Section, National Microbiology
Laboratory, Public Health Agency of Canada]

--
Jonathan Gubbay
Public Health Laboratory, Toronto
Ontario Agency for Health Protection and Promotion (OAHPP)
Toronto, ON M9P 3T1
Canada
<jonathan.gubbay@oahpp.ca>

[As in previous cases of oseltamivir resistance described in
influenza A (H1N1) virus (both seasonal and pandemic 2009 strains) up
to the present, there appears to have been no onward transmission of
oseltamivir-resistant virus to contacts or evidence of spread or
resistant virus in the general community. Likewise the evolution of
oseltamivir resistant virus during the course of treatment has not
been detrimental to final recovery even in the case of this Canadian
patient with a hematological malignancy, who ultimately succumbed to
another viral infection. However, as emphasized by the authors of the
report above, vigilance must be maintained. - Mod.CP]

[see also:
Influenza pandemic (H1N1) 2009 (73): Taiwan oseltamivir resistance
20091021.3626
Influenza pandemic (H1N1) 2009 (50): oseltamivir resistance 20090917.3260
Influenza A(H1N1) virus, oseltamivir resistance (02): N. Hemisphere
20090325.1166
Influenza A(H1N1) virus, oseltamivir resistance: Korea 20090113.0136
2008
----
Influenza A (H1N1) virus, oseltamivir resistance (10): CDC 20081224.4054
Influenza A (H1N1) virus, oseltamivir resistance (09): USA 20081220.4013
Influenza A (H1N1) virus, oseltamivir resistance (08): Europe 20081025.3375
Influenza A (H1N1) virus, oseltamivir resistance (07): Europe 20080906.2783
Influenza A (H1N1) virus, oseltamivir resistance (06): S. Hemisphere
20080825.2648
Influenza virus, oseltamivir resistance (06): Japan 20080228.0812
Influenza A (H1N1) virus, oseltamivir resistance (05): China (HK) 20080203.0438
Influenza A (H1N1) virus, oseltamivir resistance (03): corr. 20080203.0430
Influenza A (H1N1) virus, oseltamivir resistance (04): CA, USA 20080202.0428
Influenza A (H1N1) virus, oseltamivir resistance (03): Europe 20080201.0399
Influenza A (H1N1) virus, oseltamivir resistance (02): Europe 20080129.0371
Influenza A (H1N1) virus, oseltamivir resistance - Norway 20080128.0361
2006
----
Avian influenza, human (162): oseltamivir resistance 20061010.2907]
...................................cp/mj/mpp

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Wed Dec 23, 2009 2:46 pm 
Offline

Joined: Wed Aug 19, 2009 12:00 pm
Posts: 698
Repost?? Sorry if it is.

Child's body resists H1N1 drug

By Paul Turenne, WINNIPEG SUN

Last Updated: 23rd December 2009, 12:32pm


Quote:
For the first time in Manitoba, someone with H1N1 has shown resistance to an antiviral drug.

Manitoba Health reported today that someone — identified only as an individual younger than 18 with an underlying medical condition — has resisted Tamiflu, which is used in the treatment of H1N1, not in immunization.


http://www.winnipegsun.com/news/manitob ... 53491.html


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Jan 12, 2010 1:36 pm 
Offline

Joined: Wed Aug 19, 2009 2:33 pm
Posts: 1841
http://www.cidrap.umn.edu/cidrap/conten ... lobal.html

from Jan 8, 2010 CIDRAP News


Quote:
Among viruses submitted to the Global Influenza Surveillance Network, 190 cases of oseltamivir resistance have been identified so far, the WHO reported. All have shown susceptibility to zanamivir, the other neuraminidase inhibitor recommended to treat pandemic H1N1 infections. All of the viruses so far closely match the novel H1N1 virus contained in the vaccine.


CIDRAP News based upon WHO h1n1 2009 update 82
Quote:
Systematic surveillance conducted by the Global Influenza Surveillance Network (GISN) including WHOCCs, continues to detect sporadically pandemic A (H1N1) viruses that are resistant to oseltamivir. So far, antiviral susceptibility testing was conducted by WHO CCs and other GISN labs on pandemic A (H1N1) specimens and isolates from at least 86 countries, and 190 cases of oseltamivir resistance have been reported by GISN so far. All of these viruses showed H275Y mutation but all these viruses remain sensitive to zanamivir. Worldwide, more than 15,000 clinical specimens (samples and isolates) of the pandemic A (H1N1) virus have been tested and found to be sensitive to oseltamivir.

All pandemic A(H1N1) 2009 influenza viruses analysed to date were antigenically and genetically closely related to the vaccine virus A/California/7/2009.


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Jan 12, 2010 2:17 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Tex wrote:
http://www.cidrap.umn.edu/cidrap/content/influenza/swineflu/news/jan0810global.html

from Jan 8, 2010 CIDRAP News


Quote:
Among viruses submitted to the Global Influenza Surveillance Network, 190 cases of oseltamivir resistance have been identified so far, the WHO reported. All have shown susceptibility to zanamivir, the other neuraminidase inhibitor recommended to treat pandemic H1N1 infections. All of the viruses so far closely match the novel H1N1 virus contained in the vaccine.


CIDRAP News based upon WHO h1n1 2009 update 82
Quote:
Systematic surveillance conducted by the Global Influenza Surveillance Network (GISN) including WHOCCs, continues to detect sporadically pandemic A (H1N1) viruses that are resistant to oseltamivir. So far, antiviral susceptibility testing was conducted by WHO CCs and other GISN labs on pandemic A (H1N1) specimens and isolates from at least 86 countries, and 190 cases of oseltamivir resistance have been reported by GISN so far. All of these viruses showed H275Y mutation but all these viruses remain sensitive to zanamivir. Worldwide, more than 15,000 clinical specimens (samples and isolates) of the pandemic A (H1N1) virus have been tested and found to be sensitive to oseltamivir.

All pandemic A(H1N1) 2009 influenza viruses analysed to date were antigenically and genetically closely related to the vaccine virus A/California/7/2009.

The 190 cases is almost double the 96 reported on Dec 4.

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 162 posts ]  Go to page Previous  1 ... 13, 14, 15, 16, 17  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 1 guest


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group