Rhiza Labs FluTracker Forum

The place to discuss the flu

Support This Site

 

Old Comment Archive

It is currently Thu Sep 02, 2010 10:25 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 162 posts ]  Go to page Previous  1 ... 12, 13, 14, 15, 16, 17  Next
Author Message
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Dec 05, 2009 1:27 am 
Offline

Joined: Wed Aug 19, 2009 2:33 pm
Posts: 1841
2 Drug-Resistant H1N1 Cases Reported In Pa.

http://kdka.com/health/drug.resistant.H ... 51045.html


Quote:
The state lab has been testing whether the virus samples it receives would respond to this drug.

"They've detected two cases in the state, in the eastern part of the state, and I don't think that's unexpected. We're seeing growing numbers in the country of resistant viruses showing up, and we know flu mutates quite readily," Dr. Dixon continues.


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Dec 05, 2009 1:59 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/12050 ... 4Y_PA.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Dec 05, 2009 5:34 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/12050 ... enial.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sat Dec 05, 2009 9:56 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
A/Utah/42/2009 at GISAID depoisted by CDC

HA travel log

gb|U04857.1|IAU04857 Influenza A virus (H1N1) A/swine/29/37 h... 42.1 0.018

****************************

gb|CY051895.1| Influenza A virus (A/Texas/45062633/2009(H1N1)... 36.2 0.76
gb|CY049899.1| Influenza A virus (A/Moscow/0253T/2009(H1N1)) ... 36.2 0.76
gb|GU014810.1| Influenza A virus (A/Yamaguchi/23/2009(H1N1)) ... 36.2 0.76
gb|GU014778.1| Influenza A virus (A/Chiba-C/51/2009(H1N1)) se... 36.2 0.76
gb|GQ894828.1| Influenza A virus (A/Florida/16/2009(H1N1)) se... 36.2 0.76
gb|GQ377107.1| Influenza A virus (A/Utah/04/2009(H1N1)) segme... 36.2 0.76

****************************
gb|CY052019.1| Influenza A virus (A/Norway/3206-3/2009(H1N1))... 34.2 3.0
gb|GU211219.1| Influenza A virus (A/Vladivostok/01/2009(H1N1)... 34.2 3.0
gb|GU189649.1| Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(... 34.2 3.0
gb|GU112090.1| Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(... 34.2 3.0
gb|GU108486.1| Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N... 34.2 3.0
gb|CY047083.1| Influenza A virus (A/Catalonia/NS2008/2009(H1N... 34.2 3.0
gb|CY047080.1| Influenza A virus (A/Catalonia/NS2001/2009(H1N... 34.2 3.0
gb|CY047074.1| Influenza A virus (A/Catalonia/NS1706/2009(H1N... 34.2 3.0
gb|GU014750.1| Influenza A virus (A/Hiroshima/201/2009(H1N1))... 34.2 3.0
gb|GQ915017.1| Influenza A virus (A/Sao Paulo/53206/2009(H1N1... 34.2 3.0
gb|GQ457487.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 34.2 3.0
gb|GQ379822.1| Influenza A virus (A/Mexico/InDRE4114/2009(H1N... 34.2 3.0
gb|GQ374893.1| Influenza A virus (A/reassortant/IDCDC-RG18(Te... 34.2 3.0
gb|GQ280121.1| Influenza A virus (A/reassortant/NIBRG-121(Cal... 34.2 3.0
gb|GQ229348.1| Influenza A virus (A/swine/Hong Kong/NS857/200... 34.2 3.0
gb|GQ229261.1| Influenza A virus (A/swine/Hong Kong/NS837/200... 34.2 3.0
gb|GQ232076.1| Influenza A virus (A/Texas/11/2009(H1N1)) segm... 34.2 3.0
gb|GQ200237.1| Influenza A virus (A/Georgia/01/2009(H1N1)) se... 34.2 3.0
gb|GQ162194.1| Influenza A virus (A/Mexico/3955/2009(H1N1)) s... 34.2 3.0
gb|GQ160568.1| Influenza A virus (A/New York/04/2009(H1N1)) s... 34.2 3.0
gb|GQ132145.1| Influenza A virus (A/Mexico/InDRE4114/2009(H1N... 34.2 3.0

*********************************
gb|GQ229293.1| Influenza A virus (A/swine/Hong Kong/NS1659/20... 34.2 3.0

**********************************
gb|GQ377107.1| Influenza A virus (A/Utah/04/2009(H1N1)) segme... 36.2 0.76
gb|FJ986618.1| Influenza A virus (A/Iowa/01/2006(H1N1)) segme... 36.2 0.76
gb|FJ750522.1| Influenza A virus (A/ferret/Iowa/15828B/2008(H... 36.2 0.76
gb|EU798779.1| Influenza A virus (A/swine/Korea/CAS08/2005(H1... 36.2 0.76
gb|EU798778.1| Influenza A virus (A/swine/Korea/CAN01/2004(H1... 36.2 0.76
gb|EU139832.1| Influenza A virus (A/swine/Iowa/00239/2004(H1N... 36.2 0.76
gb|DQ889689.1| Influenza A virus (A/Iowa/CEID23/2005(H1N1)) h... 36.2 0.76
gb|AY060049.1| Influenza A virus (A/SW/MO/1877/01(H1N2)) hema... 36.2 0.76
gb|AF455679.1| Influenza A virus (A/Swine/Iowa/930/01(H1N2)) ... 36.2 0.76

The above travle log was from a Utah/42 sequences designated M1 (presumably cloned once in MCDK cells). However, the original sequence, which was also deposited at GISAID had mixed signals at tandem positions which could code for D225G and D225N.

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Sun Dec 06, 2009 8:11 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/12060 ... _Utah.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Wed Dec 09, 2009 2:10 pm 
Offline

Joined: Wed Aug 19, 2009 2:33 pm
Posts: 1841
as of November 25th - summary since April - resistance found in USA and UK

http://translate.googleusercontent.com/ ... 5Zwj1TPtyw
at the middle of the page, under International Situation, there is a link to the pdf in English.


Clusters of A (H1N1) 2009 resistant oseltamivir, USA and Great Britain - Nov 25, 2009


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Fri Dec 11, 2009 7:56 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
LOCUS AB537490 1410 bp cRNA linear VRL 11-DEC-2009
DEFINITION Influenza A virus (A/Nagasaki/HA-58/2009(H1N1)) NA gene for
neuraminidase, complete cds.
ACCESSION AB537490
VERSION AB537490.1 GI:271280810
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Nagasaki/HA-58/2009(H1N1))
ORGANISM Influenza A virus (A/Nagasaki/HA-58/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1
AUTHORS Kawano,H. and Kobayashi,N.
TITLE Pandemic 2009 influenza virus (H1N1) isolated in Nagasaki-city
Nagasaki, Japan
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1410)
AUTHORS Kawano,H. and Kobayashi,N.
TITLE Direct Submission
JOURNAL Submitted (08-DEC-2009) Contact:Nobuyuki Kobayashi Graduate School
of Biomedical Sciences, Nagasaki University, Laboratory of
Molecular Biology of Infectious Agents; 1-14 Bunkyo-machi,
Nagasaki, Nagasaki 852-8521, Japan
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus
(A/Nagasaki/HA-58/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Nagasaki/HA-58/2009"
/serotype="H1N1"
/host="Homo sapiens 6 year old female"
/db_xref="taxon:697296"
/segment="6"
/lab_host="Canis lupus familiaris MDCK cells"
/country="Japan:Nagasaki"
/collection_date="27-Oct-2009"
/note="lineage: swl;
resistance to oseltamivir"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="BAI53535.1"
/db_xref="GI:271280811"
/translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQN
QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSK
DNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMS
CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKS
WRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVKSVEMNAPNYYY
EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGS
CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTETDNNFSIKQD
IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNS
DTVGWSWPDGAELPFTIDK"
ORIGIN
1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
181 tgggtaaatc aaacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
301 agtaaagaca acagtataag aatcggttcc aagggggatg tgtttgtcat aagggaacca
361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
721 gtaatgaccg atggaccaag tgatggacag gcctcataca agatcttcag aatagaaaag
781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
1141 actgagacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcgga
1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
1381 gctgagttgc catttaccat tgacaagtaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 15, 2009 10:48 pm 
Offline

Joined: Tue Dec 15, 2009 10:47 pm
Posts: 1
thanks for your information.


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 15, 2009 10:56 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
msletner,
Welcome to Flutrackers!

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Cases of Tamiflu (or other anti-viral resistance)
PostPosted: Tue Dec 15, 2009 11:13 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
NA travel log

gb|CY052881.1| Influenza A virus (A/Texas/45024243/2009(H1N1)... 38.2 0.19
gb|CY052657.1| Influenza A virus (A/Texas/45093846/2009(H1N1)... 38.2 0.19
dbj|AB537490.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 38.2 0.19
gb|GU052520.1| Influenza A virus (A/chicken/Scotland/1959(H5N... 38.2 0.19
gb|GU134722.1| Influenza A virus (A/Italy/169/2009(H1N1)) seg... 38.2 0.19
emb|AM777826.1| Influenza A virus (A/swine/Cotes d'Armor/6029... 38.2 0.19
emb|AM777825.1| Influenza A virus (A/swine/Cotes d'Armor/9857... 38.2 0.19
gb|CY015083.1| Influenza A virus (A/chicken/Scotland/1959(H5N... 38.2 0.19
gb|AY207540.1| Influenza A virus (A/mallard/Stralsund/41-6/81... 38.2 0.19
gb|CY005607.1| Influenza A virus (A/chicken/Hong Kong/17/1977... 38.2 0.19
emb|AJ410567.1| Influenza A virus genomic RNA for neuraminida... 38.2 0.19
emb|AJ410566.1| Influenza A virus genomic RNA for neuraminida... 38.2 0.19
emb|AJ416625.1| Influenza A virus (A/chicken/Scotland/59(H5N1... 38.2 0.19
gb|K02252.1|FLANAKB Influenza A virus (A/parrot/Ulster/1973(H... 38.2 0.19

******************************
dbj|AB537490.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 36.2 0.76
gb|CY052027.1| Influenza A virus (A/Catalonia/NS7362/2009(H1N... 36.2 0.76
gb|GU216651.1| Influenza A virus (A/Pavia/21/2009(H1N1)) segm... 36.2 0.76
emb|FN434454.1| Influenza A virus (A/Quebec/147365/2009(H1N1)... 36.2 0.76
gb|GU014807.1| Influenza A virus (A/Tokushima/2/2009(H1N1)) s... 36.2 0.76
gb|GU014791.1| Influenza A virus (A/Iwate/3/2009(H1N1)) segme... 36.2 0.76
gb|GQ894921.1| Influenza A virus (A/Texas/47/2009(H1N1)) segm... 36.2 0.76
gb|GQ499337.1| Influenza A virus (A/Washington/28/2009(H1N1))... 36.2 0.76
gb|GQ499335.1| Influenza A virus (A/Washington/29/2009(H1N1))... 36.2 0.76
gb|GQ463202.1| Influenza A virus (A/Hunan/SWL3/2009(H1N1)) se... 36.2 0.76
gb|CY043352.1| Influenza A virus (A/Denmark/528/2009(H1N1)) s... 36.2 0.76
gb|GQ397279.1| Influenza A virus (A/Yamaguchi/22/2009(H1N1)) ... 36.2 0.76
gb|GQ365445.1| Influenza A virus (A/Osaka/180/2009(H1N1)) seg... 36.2 0.76
gb|GQ351316.1| Influenza A virus (A/Hong Kong/2369/2009(H1N1)... 36.2 0.76
***************************

dbj|AB537490.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 38.2 0.19
gb|GQ338413.1| Influenza A virus (A/Tennessee/06/2009(H1N1)) ... 38.2 0.19
***************************

dbj|AB537490.1| Influenza A virus (A/Nagasaki/HA-58/2009(H1N1... 34.2 3.0
gb|CY048935.1| Influenza A virus (A/Malaysia/854/2009(H1N1)) ... 34.2 3.0
gb|GQ387387.1| Influenza A virus (A/Catalonia/446/2009(H1N1))... 34.2 3.0
gb|GQ387386.1| Influenza A virus (A/Catalonia/434/2009(H1N1))... 34.2 3.0
gb|GQ379838.1| Influenza A virus (A/Catalonia/470/2009(H1N1))... 34.2 3.0
gb|GQ379835.1| Influenza A virus (A/Catalonia/456/2009(H1N1))... 34.2 3.0
gb|GQ379834.1| Influenza A virus (A/Catalonia/443/2009(H1N1))... 34.2 3.0
gb|GQ379832.1| Influenza A virus (A/Catalonia/423/2009(H1N1))... 34.2 3.0
gb|GQ379830.1| Influenza A virus (A/Catalonia/414/2009(H1N1))... 34.2 3.0
gb|GQ379829.1| Influenza A virus (A/Catalonia/412/2009(H1N1))... 34.2 3.0
gb|GQ379826.1| Influenza A virus (A/Catalonia/405/2009(H1N1))... 34.2 3.0
gb|GQ355301.1| Influenza A virus (A/Catalonia/398/2009(H1N1))... 34.2 3.0

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 162 posts ]  Go to page Previous  1 ... 12, 13, 14, 15, 16, 17  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 1 guest


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group